Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24910 65 / 2e-13 ELA1, CYP714A1 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) AT5G24900 62 / 2e-12 ELA2, CYP714A2 EUI-like p450 A2, cytochrome P450, family 714, subfamily A, polypeptide 2 (.1) AT1G67110 46 / 7e-07 CYP735A2 "cytochrome P450, family 735, subfamily A, polypeptide 2", cytochrome P450, family 735, subfamily A, polypeptide 2 (.1) AT2G46960 45 / 2e-06 CYP709B1 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) AT5G52400 45 / 3e-06 CYP715A1 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1) AT5G38450 44 / 4e-06 CYP735A1 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) AT2G46950 42 / 3e-05 CYP709B2 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) AT1G75130 39 / 0.0002 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008423 [exp] 162 / 2e-48 AT5G24910 462 / 9e-159 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Lus10033555 [exp] 50 / 4e-08 AT5G38450 694 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Lus10017595 [exp] 50 / 6e-08 AT5G38450 697 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Lus10026085 [exp] 46 / 1e-06 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) Lus10036818 [exp] 45 / 2e-06 AT2G26710 369 / 2e-122 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10017775 [exp] 45 / 2e-06 AT3G14630 359 / 2e-117 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10005788 [exp] 45 / 3e-06 AT5G64790 565 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10036817 [exp] 44 / 6e-06 AT2G26710 382 / 3e-121 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10019177 [exp] 43 / 1e-05 AT2G26710 373 / 4e-124 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G064200 [exp] 53 / 4e-09 AT5G24910 652 / 0.0 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.008G026300 [exp] 52 / 6e-09 AT5G24910 486 / 5e-168 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.008G026200 [exp] 50 / 4e-08 AT5G24910 488 / 8e-169 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.004G100400 [exp] 49 / 1e-07 AT5G38450 734 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Potri.013G160800 [exp] 48 / 2e-07 AT5G24910 468 / 6e-161 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.017G114200 [exp] 47 / 4e-07 AT5G38450 724 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) Potri.010G139400 [exp] 39 / 0.0002 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139500 [exp] 39 / 0.0003 AT3G14620 283 / 4e-90 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.002G134500 [exp] 39 / 0.0003 AT1G75130 540 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003361 pacid=23161700 polypeptide=Lus10003361 locus=Lus10003361.g ID=Lus10003361.BGIv1.0 annot-version=v1.0 ATGACGACGACGACGACAATGAAGGAGATGGCGGTAGCAGCCGGAACCCTCCTGGGAGCGATACTGGGTTTCGTAGCGGCGTACATATCGATCGTCTACA TGTGGAAGCCATGGCGTCTGAGAAGGAAGCTGGTGAATCAAGGAGTCAAAGGACCTTCTCCTTCCAATTCCTTTCTCGGCAACATCCCCGACATCAACCG TATTCGTAGTCTCTCCAAAAAACCGGTTGATTCTTCCGGCAATGGCATCGATCACGATTGGCCTTCCGTTCTCTTGCCCCACCTCCGCCTCTGGTTCAAG CAATACCGTAAGGAGAAACATTATGATTTGAAATAA
AA sequence Show only first row Show all	>Lus10003361 pacid=23161700 polypeptide=Lus10003361 locus=Lus10003361.g ID=Lus10003361.BGIv1.0 annot-version=v1.0 MTTTTTMKEMAVAAGTLLGAILGFVAAYISIVYMWKPWRLRRKLVNQGVKGPSPSNSFLGNIPDINRIRSLSKKPVDSSGNGIDHDWPSVLLPHLRLWFK QYRKEKHYDLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24910		ELA1, CYP714A1	EUI-like p450 A1, cytochrome P...		Lus10003361 [exp]	0	1
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008919 [exp]	4.9	0.7267
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	6.9	0.7267
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10017997 [exp]	8.5	0.7267
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	9.8	0.7267
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	11.0	0.7267
					Lus10014629 [exp]	13.0	0.7219
					Lus10032804 [exp]	13.7	0.7205
AT1G55790			Domain of unknown function (DU...		Lus10032900 [exp]	14.7	0.7190
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10021456 [exp]	15.6	0.7178
AT3G47570			Leucine-rich repeat protein ki...		Lus10030856 [exp]	16.4	0.7148

Compare expression of checked genes

Lus10003361 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.