Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02450 170 / 7e-53 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT5G39820 126 / 2e-36 NAC ANAC094 NAC domain containing protein 94 (.1) AT1G26870 125 / 2e-35 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT2G17040 116 / 6e-33 NAC ANAC036 NAC domain containing protein 36 (.1) AT2G43000 115 / 9e-33 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1) AT1G77450 106 / 2e-29 NAC ANAC032 NAC domain containing protein 32 (.1) AT1G01720 107 / 3e-29 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G61110 107 / 5e-29 NAC ANAC025 NAC domain containing protein 25 (.1) AT4G27410 106 / 5e-29 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT4G17980 104 / 1e-28 NAC ANAC071 NAC domain containing protein 71 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008420 [exp] 196 / 6e-63 AT2G02450 320 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10008419 [exp] 172 / 6e-53 AT2G02450 327 / 7e-109 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10003367 [exp] 169 / 2e-51 AT2G02450 333 / 3e-110 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10023208 [exp] 163 / 1e-50 AT2G02450 321 / 3e-108 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10008897 [exp] 163 / 1e-50 AT2G02450 315 / 5e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10007263 [exp] 121 / 2e-34 AT5G39820 300 / 3e-100 NAC domain containing protein 94 (.1) Lus10015367 [exp] 119 / 1e-33 AT1G26870 298 / 8e-99 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10030478 [exp] 120 / 2e-33 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1) Lus10036749 [exp] 119 / 8e-33 AT1G26870 306 / 4e-100 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G046700 [exp] 179 / 2e-56 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.004G230800 [exp] 163 / 3e-50 AT2G02450 311 / 2e-103 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.005G205400 [exp] 117 / 4e-33 AT2G43000 269 / 6e-90 NAC domain containing protein 42 (.1) Potri.017G082000 [exp] 116 / 5e-32 AT1G26870 299 / 3e-98 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.019G031400 [exp] 113 / 3e-31 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2) Potri.004G126901 [exp] 114 / 4e-31 AT5G39820 305 / 1e-101 NAC domain containing protein 94 (.1) Potri.011G046700 [exp] 113 / 4e-31 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.001G080900 [exp] 110 / 2e-30 AT2G43000 257 / 3e-85 NAC domain containing protein 42 (.1) Potri.002G057200 [exp] 110 / 2e-30 AT2G43000 282 / 4e-95 NAC domain containing protein 42 (.1) Potri.007G066300 [exp] 110 / 2e-30 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10003366 pacid=23161711 polypeptide=Lus10003366 locus=Lus10003366.g ID=Lus10003366.BGIv1.0 annot-version=v1.0 ATGAGCAATGAGAAAATTAATAGCAGCAGCAGCAGCCCTCCCCTTGATGATGACGAGGAAGCTGATCAGAAAGATGAGCACGAGAACGACATGGTGATGC CGGGGTTTAGGTTTCATCCCACGGAGGAAGAGCTCGTAGAGTTCTACCTTCGCCGTAAGGTTGAGGGCAAACGCTTCAACGTTGAGCTCATTACTTTTCT CGACCTTTATCGCTACGATCCATGGGAGCTCCCTGCTATGGCGGCGATTGGGGAGGAGTGGTTCTTCTATGTTCCGAGAGACAGGAAGTATAGGAACGGT GACCGGCCGAATCGGGTGACGACTTCTGGTTACTTACTGGAAGGCTACTGGGGCTGA
AA sequence Show only first row Show all	>Lus10003366 pacid=23161711 polypeptide=Lus10003366 locus=Lus10003366.g ID=Lus10003366.BGIv1.0 annot-version=v1.0 MSNEKINSSSSSPPLDDDEEADQKDEHENDMVMPGFRFHPTEEELVEFYLRRKVEGKRFNVELITFLDLYRYDPWELPAMAAIGEEWFFYVPRDRKYRNG DRPNRVTTSGYLLEGYWG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10003366 [exp]	0	1
					Lus10032733 [exp]	2.8	0.7028
AT1G05660			Pectin lyase-like superfamily ...		Lus10010584 [exp]	3.2	0.7325
AT1G53000		AtCKS, KDSB	CMP-KDO synthetase, Nucleotide...		Lus10040889 [exp]	5.6	0.7573
AT5G39190		ATGER2, GLP2A	GERMIN-LIKE PROTEIN 2A, A. THA...		Lus10033764 [exp]	6.9	0.6768
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Lus10022104 [exp]	11.2	0.6832
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10017904 [exp]	15.8	0.7150
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005194 [exp]	17.5	0.6757
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	18.8	0.6757
AT1G04670			unknown protein		Lus10002298 [exp]	19.9	0.6757
					Lus10027667 [exp]	21.0	0.6757

Compare expression of checked genes

Lus10003366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.