Lus10003370 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008418 62 / 5e-13 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10003370 pacid=23161698 polypeptide=Lus10003370 locus=Lus10003370.g ID=Lus10003370.BGIv1.0 annot-version=v1.0
ATGCATATAGCCATTATTCATGCGTTTGTACTGTTTCTGGCGGCCGCCGTAGTCAGCGGCGATATTCCACTGGGAGCATGCGGAGACGGGAACGCAGACG
CTGACGTGGCAACGGTGGTGATGCTGATAAAGGACCTGGTCAACAATGTACCATTTGCCGACGGGCTCAACTACTGCAACACCGTGGACTATGACGACGT
GAAGATGTACGGGTTCGCCAAATGTAAACCGGGGGACGGCAGCTCTATGGACTTGAGTTACTGCTTCCAGTGTCTGGAACTTGTGGGTGACTACCTTGTT
AAAACCTGCGACGATACCGGCGTTGGTCATGCGTGGGACATTGATAGTTCTTGTTATTAA
AA sequence
>Lus10003370 pacid=23161698 polypeptide=Lus10003370 locus=Lus10003370.g ID=Lus10003370.BGIv1.0 annot-version=v1.0
MHIAIIHAFVLFLAAAVVSGDIPLGACGDGNADADVATVVMLIKDLVNNVPFADGLNYCNTVDYDDVKMYGFAKCKPGDGSSMDLSYCFQCLELVGDYLV
KTCDDTGVGHAWDIDSSCY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003370 0 1
Lus10030331 4.0 0.8994
AT1G32730 unknown protein Lus10000258 5.3 0.8650
AT2G43870 Pectin lyase-like superfamily ... Lus10011417 5.8 0.8864
Lus10017802 6.5 0.7935
AT3G53710 AGD6 ARF-GAP domain 6 (.1.2) Lus10012991 7.1 0.8864
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10014056 8.2 0.8864
AT1G02335 GL22 germin-like protein subfamily ... Lus10004856 9.2 0.8864
AT3G05610 Plant invertase/pectin methyle... Lus10020681 9.5 0.8049
Lus10039432 10.1 0.8864
Lus10002332 10.9 0.8864

Lus10003370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.