Lus10003373 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52960 291 / 2e-100 Thioredoxin superfamily protein (.1)
AT1G65980 194 / 4e-63 TPX1 thioredoxin-dependent peroxidase 1 (.1.2)
AT1G60740 189 / 2e-61 Thioredoxin superfamily protein (.1)
AT1G65970 189 / 4e-61 TPX2 thioredoxin-dependent peroxidase 2 (.1)
AT1G65990 144 / 5e-40 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein (.1)
AT3G06050 109 / 1e-29 PRXIIF, ATPRXIIF peroxiredoxin IIF (.1)
AT1G48130 41 / 0.0003 ATPER1 1-cysteine peroxiredoxin 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002843 425 / 2e-153 AT3G52960 290 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10023662 181 / 9e-58 AT1G65980 264 / 5e-92 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10023180 177 / 2e-56 AT1G65980 268 / 2e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10015077 176 / 9e-56 AT1G65980 268 / 3e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10021932 108 / 2e-28 AT3G06050 317 / 6e-111 peroxiredoxin IIF (.1)
Lus10041218 87 / 8e-20 AT3G06050 243 / 3e-79 peroxiredoxin IIF (.1)
Lus10018342 42 / 0.0002 AT1G48130 338 / 2e-119 1-cysteine peroxiredoxin 1 (.1)
Lus10017112 41 / 0.0004 AT1G48130 335 / 3e-118 1-cysteine peroxiredoxin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G102100 326 / 2e-114 AT3G52960 278 / 1e-95 Thioredoxin superfamily protein (.1)
Potri.018G083500 188 / 6e-61 AT1G65980 280 / 4e-98 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.001G423500 188 / 6e-61 AT1G65980 285 / 5e-100 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.019G024000 100 / 9e-26 AT3G06050 311 / 2e-109 peroxiredoxin IIF (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF08534 Redoxin Redoxin
Representative CDS sequence
>Lus10003373 pacid=23175204 polypeptide=Lus10003373 locus=Lus10003373.g ID=Lus10003373.BGIv1.0 annot-version=v1.0
ATGGCTTCCTCTCTCTCAGTCTCCAGAATCTTCCTCGCCTCACCCACTGCCGTCGCCGCCACCACCAAATCTCTCCTCCCTTCTGTCACCATCTCCGCCA
ACCTCTCTCCTCTCACCTCCCCCAAACTCAATCTCCGATTCAACCGCACCAACCTAGCCAAACGATTCTCCGCCAAATCAGTTCCCTCAATCTCCGCCTC
GATCTCCGTCGGCGATAAGCTCCCCGAAGCCACGCTCTCCTACCTGGACGCCGACAACGAGGTCCAGACCGTGACCGTCTCCTCCCTCACAGCCGGCAAG
AAGGCCATCCTCTTCGCCGTCCCCGGGGCGTTCACCCCGACCTGCTCGCAGAAGCACCTCCCAGGGTTTGTGGAGAAGGCTTCGGAGCTGAAATCGAAAG
GAGTGGACACGATCGCCTGCGTGTCGGTGAACGATGTGTTCGTCATGAAGGCGTGGAAGGAGAATTTGGGGATTACGGATGAGGGTGATGTTTTGCTGCT
CTCCGATGGGAATTTGGAGTTCACTAAGGCGATTGGTTGCGAGCTGGATCTGAGCGATAAGCCGGTGGGGCTTGGGGTTAGGTCTAGGAGGTATGCGTTG
CTGGCGGAGGACGGCGTCGTTAAGGTGCTGAATTTGGAGGAAGGCGGCGCGTTTACCTCCAGCGGAGCTGAGGATATGCTCAAGGCACTGTGA
AA sequence
>Lus10003373 pacid=23175204 polypeptide=Lus10003373 locus=Lus10003373.g ID=Lus10003373.BGIv1.0 annot-version=v1.0
MASSLSVSRIFLASPTAVAATTKSLLPSVTISANLSPLTSPKLNLRFNRTNLAKRFSAKSVPSISASISVGDKLPEATLSYLDADNEVQTVTVSSLTAGK
KAILFAVPGAFTPTCSQKHLPGFVEKASELKSKGVDTIACVSVNDVFVMKAWKENLGITDEGDVLLLSDGNLEFTKAIGCELDLSDKPVGLGVRSRRYAL
LAEDGVVKVLNLEEGGAFTSSGAEDMLKAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52960 Thioredoxin superfamily protei... Lus10003373 0 1
AT3G52960 Thioredoxin superfamily protei... Lus10002843 1.0 0.9678
AT2G31670 Stress responsive alpha-beta b... Lus10017873 1.4 0.9339
AT5G52640 AtHsp90-1, ATHS... HEAT SHOCK PROTEIN 83, HEAT SH... Lus10027303 7.7 0.8923
AT5G52640 AtHsp90-1, ATHS... HEAT SHOCK PROTEIN 83, HEAT SH... Lus10039008 8.8 0.8964
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Lus10023418 10.2 0.9108
AT4G29680 Alkaline-phosphatase-like fami... Lus10032681 10.6 0.9010
AT3G08640 Protein of unknown function (D... Lus10035607 11.0 0.8951
AT4G22580 Exostosin family protein (.1) Lus10004341 11.5 0.8970
AT4G15248 CO B-box type zinc finger family ... Lus10015097 11.6 0.8991
AT3G07270 GTP cyclohydrolase I (.1.2) Lus10002353 13.4 0.8548

Lus10003373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.