Lus10003382 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16835 213 / 6e-65 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G01580 196 / 3e-58 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G24000 194 / 1e-57 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21300 196 / 2e-57 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G01510 192 / 2e-57 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49170 195 / 3e-57 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G14820 194 / 3e-57 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G57430 195 / 4e-57 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G20230 194 / 4e-57 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G14850 193 / 4e-57 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019213 489 / 5e-173 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10004304 315 / 4e-110 AT1G11290 123 / 2e-32 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10006815 296 / 3e-103 AT1G20230 116 / 6e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013149 206 / 8e-62 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10004987 202 / 8e-62 AT3G46790 715 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022890 203 / 4e-60 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024936 202 / 6e-60 AT3G61170 855 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008967 202 / 2e-59 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015898 199 / 9e-59 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G119000 213 / 6e-65 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G006400 213 / 1e-64 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G220300 210 / 3e-63 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G005400 207 / 2e-62 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G104700 207 / 3e-62 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G077700 204 / 5e-62 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G091600 206 / 8e-62 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G155100 206 / 3e-61 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G001200 202 / 5e-61 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G187800 205 / 2e-60 AT3G09040 1201 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10003382 pacid=23175212 polypeptide=Lus10003382 locus=Lus10003382.g ID=Lus10003382.BGIv1.0 annot-version=v1.0
ATGTACTTCAAATGTGGTGATACGGGATCATCCAGGAGATTGTTCGAAGGAAGGGTAATGAAGGATGTTGTGTCCTGGAACTCAATAATTACTGGATTTG
CACATAACGGGCTTGCAGATGAATCACTTGTGATCTTCAGAGAGATGGTTCAGGGGAGGAATACAATTCCTAATCATGTGACCTTTCTAGGTGTCTTGTT
TGCTTGTAGCCATACAGGATCACTTTCTGAAGCACTTGGTGTTCTAGAGCAGATGGAAAATAGTTATCATATTTTCCCAAGATCAGAACACTATGCAATC
TTGGTTGATTTAGTAGGTAGGAAAAACAGACTGAGCGAAGCGATGGAGTTAGTCGAAAAAACTCCTGGTCTATCGGAGCATGCGGGGATATGGGGCGCTC
TATTAGGTGCTTGTCGGATCCATCACAATGTGGGTCTTGCCATGAAGGCTGCGGAAACTCTATTCAAATTAGAACCCGGGAATCCTGGAAGATATGTCAT
GTTAGCGAATGTTTATACATCAGCTAATAAATGGAGTGATGCTTCAAGAATGAGAAGGGAAGTGGATGAAAAAGGTCTAGTTAAAGATGTAGCTTACAGT
TGGATTGAGGTGAGGAATGAGAGGCATGAGTTTGTGGCCAAGGACAAGGCTCACAGACAGATACAAGAAGTATATGAAGCAATCCCTCGACTACTTGATC
ATATGAGGGAAGCTGGACACTGGCCTTCCACAAATGACTTTGGATCGTCGGAGAAGATGATGTCCTAG
AA sequence
>Lus10003382 pacid=23175212 polypeptide=Lus10003382 locus=Lus10003382.g ID=Lus10003382.BGIv1.0 annot-version=v1.0
MYFKCGDTGSSRRLFEGRVMKDVVSWNSIITGFAHNGLADESLVIFREMVQGRNTIPNHVTFLGVLFACSHTGSLSEALGVLEQMENSYHIFPRSEHYAI
LVDLVGRKNRLSEAMELVEKTPGLSEHAGIWGALLGACRIHHNVGLAMKAAETLFKLEPGNPGRYVMLANVYTSANKWSDASRMRREVDEKGLVKDVAYS
WIEVRNERHEFVAKDKAHRQIQEVYEAIPRLLDHMREAGHWPSTNDFGSSEKMMS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16835 Tetratricopeptide repeat (TPR)... Lus10003382 0 1
AT1G20230 Pentatricopeptide repeat (PPR)... Lus10006815 1.0 0.8830
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10004303 10.3 0.8402
AT5G38730 Tetratricopeptide repeat (TPR)... Lus10032174 11.6 0.8112
AT4G02400 U3 ribonucleoprotein (Utp) fam... Lus10007881 15.0 0.8052
AT1G52640 Pentatricopeptide repeat (PPR)... Lus10030603 24.1 0.8003
AT5G14770 Tetratricopeptide repeat (TPR)... Lus10026206 36.2 0.7915
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10003383 36.4 0.8023
AT1G13630 Tetratricopeptide repeat (TPR)... Lus10036836 48.2 0.7720
AT4G01860 Transducin family protein / WD... Lus10038045 54.0 0.7811
AT4G24970 Histidine kinase-, DNA gyrase ... Lus10016745 65.5 0.7564

Lus10003382 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.