Lus10003383 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G13600 124 / 8e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G08070 118 / 2e-30 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G21090 115 / 1e-29 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G62890 114 / 3e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G20540 112 / 9e-29 MEF21 mitochondrial editing factor 21 (.1)
AT3G22690 112 / 1e-28 unknown protein
AT5G08305 108 / 2e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G37380 108 / 3e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G06540 106 / 2e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G37170 104 / 6e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004303 371 / 2e-132 AT2G21090 146 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10019213 345 / 4e-117 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10011025 187 / 3e-61 AT2G13600 77 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10004114 151 / 5e-47 AT3G13880 96 / 5e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014009 146 / 6e-45 AT3G13880 89 / 2e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030125 137 / 5e-38 AT2G20540 618 / 0.0 mitochondrial editing factor 21 (.1)
Lus10017386 122 / 3e-33 AT5G08305 357 / 9e-120 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010183 123 / 1e-32 AT5G08305 529 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016425 116 / 7e-30 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G035900 121 / 6e-32 AT2G20540 709 / 0.0 mitochondrial editing factor 21 (.1)
Potri.017G091600 121 / 1e-31 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G175900 112 / 8e-29 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G073100 112 / 9e-29 AT5G08305 600 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G245300 112 / 1e-28 AT3G22690 570 / 0.0 unknown protein
Potri.003G031600 112 / 2e-28 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G035900 110 / 6e-28 AT1G74630 884 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G316500 109 / 1e-27 AT1G04840 728 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G085800 109 / 1e-27 AT4G02750 491 / 3e-164 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G217600 109 / 1e-27 AT1G05750 548 / 0.0 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10003383 pacid=23175225 polypeptide=Lus10003383 locus=Lus10003383.g ID=Lus10003383.BGIv1.0 annot-version=v1.0
ATGGATTCTGCCTCAGTAATCGACGAATACGGAAGTTTACTATCGACATGCATCACATCCAGGAACCTCAAATTGGGCAAGGCAATTCATTCCAACCTCA
TCAAAACCGCGATCAACTTCAACTCCTTCGTCGTTAATCGTCTAATCGACATGTACTCCAAATGCAGTTCTATCGGATCCGCCCATAAGGCCTTCGACGA
TCTCCCCTTCAAGAACGCTCGTTCCTGGAACACCATCGTCTCCGCCTGCTCCAAATTGGGTATGGTGAAAATGGCGCGGAAACTGTTCGATGAAATGCCT
GACCGAAATCTCGTCAGCTACAACTCAATGATTTCGGGGCTTTCTCGTGGTGGGTATTACAAGGAGGCGTTGGGTATGTTCATGAGATTGCAGGAAGATT
GCGTTGGGGGGTTTTGTTTGGATGACTTTACTGTTGTGAGTGTGGTGAGTTGTTGTGCGAGCTTTCGTGGGTTGGAATTGGTTCGTCAGCTGCATGGTGT
GGGATTAGTTGTTGGGTTGGAAGGGAATGTGGTGTTGCTGAACTCTGTGGTTGATGCTTATGGGAAATGTGGGGAACCTGATGTTAGTTTCCGTGTATTT
AGCAGGATGAATGAAAGGGATGTTGTGTCGTGGACGTAA
AA sequence
>Lus10003383 pacid=23175225 polypeptide=Lus10003383 locus=Lus10003383.g ID=Lus10003383.BGIv1.0 annot-version=v1.0
MDSASVIDEYGSLLSTCITSRNLKLGKAIHSNLIKTAINFNSFVVNRLIDMYSKCSSIGSAHKAFDDLPFKNARSWNTIVSACSKLGMVKMARKLFDEMP
DRNLVSYNSMISGLSRGGYYKEALGMFMRLQEDCVGGFCLDDFTVVSVVSCCASFRGLELVRQLHGVGLVVGLEGNVVLLNSVVDAYGKCGEPDVSFRVF
SRMNERDVVSWT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10003383 0 1
AT3G46960 RNA helicase, ATP-dependent, S... Lus10017528 8.7 0.9026
AT1G56570 PGN PENTATRICOPEPTIDE REPEAT PROTE... Lus10014027 9.2 0.8926
AT1G52640 Pentatricopeptide repeat (PPR)... Lus10030603 9.4 0.8620
AT1G77300 ASHH2, CCR1, SD... LAZARUS 2, CAROTENOID CHLOROPL... Lus10028662 10.3 0.9004
AT4G23540 ARM repeat superfamily protein... Lus10035446 13.5 0.9002
AT1G50140 P-loop containing nucleoside t... Lus10013429 21.8 0.8883
AT2G31340 EMB1381 embryo defective 1381 (.1) Lus10035336 22.1 0.8776
AT5G61460 SMC6B, ATRAD18,... STRUCTURAL MAINTENANCE OF CHRO... Lus10038928 23.8 0.8709
AT4G17610 tRNA/rRNA methyltransferase (S... Lus10011019 24.1 0.8815
AT3G26540 Tetratricopeptide repeat (TPR)... Lus10015584 27.2 0.8762

Lus10003383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.