Lus10003390 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43770 236 / 4e-79 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G08390 67 / 7e-14 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G11160 67 / 8e-14 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G61210 66 / 2e-13 DWA3 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G23430 66 / 3e-13 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT2G41500 61 / 1e-11 EMB2776, LIS LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
AT5G64730 59 / 5e-11 Transducin/WD40 repeat-like superfamily protein (.1)
AT3G49660 57 / 2e-10 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
AT4G29830 55 / 9e-10 VIP3 vernalization independence 3, Transducin/WD40 repeat-like superfamily protein (.1)
AT2G16780 54 / 3e-09 MSI02, NFC2, NFC02, MSI2 NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP C 2, MULTICOPY SUPPRESSOR OF IRA1 2, Transducin family protein / WD-40 repeat family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012230 256 / 8e-87 AT2G43770 620 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10002860 250 / 2e-84 AT2G43770 617 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10002211 100 / 6e-29 AT2G43770 96 / 6e-26 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10011224 68 / 4e-14 AT1G11160 665 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10018458 68 / 4e-14 AT1G11160 668 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10021059 67 / 7e-14 AT2G41500 706 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10004167 67 / 7e-14 AT2G41500 708 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10041007 63 / 2e-12 AT5G23430 721 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10013452 62 / 3e-12 AT1G50410 1003 / 0.0 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G096900 241 / 7e-81 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.013G128001 107 / 3e-31 AT2G43770 196 / 2e-63 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.011G045500 68 / 3e-14 AT1G61210 723 / 0.0 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.006G045800 65 / 3e-13 AT2G41500 614 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Potri.008G002300 63 / 2e-12 AT5G08390 1006 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.010G255400 61 / 7e-12 AT5G08390 927 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.007G009500 58 / 9e-11 AT3G49660 469 / 4e-168 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G148500 57 / 2e-10 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.010G026800 56 / 5e-10 AT4G03020 676 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.002G051900 53 / 4e-09 AT4G02730 524 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Lus10003390 pacid=23175227 polypeptide=Lus10003390 locus=Lus10003390.g ID=Lus10003390.BGIv1.0 annot-version=v1.0
ATGAAGCTCGAGGGGCATCAGGACATGGTCACAGGAATGCAGCTGAGCCCTGACGGCTCTTATCTTCTGACGAATGGTATGGATTGCAAGCTGTGTGTAT
GGGATATGAGGCCTTACGCTCCTCAGAACTGGTGCCTGAAGGTTCTCGAAGGGCATCAGCAAATTTTCGAGAAGAATCTGCTGAAATGCAGCTGGTCTCC
CGATGGAATTAAGGTGAGTGCTGGTACGTCGGACCGGATGGTGTACATATGGGACACGACTTCGAGACGGATACTGTACAAGCTTCCTGAGCACACGGGG
TCGGTTAATGAGTGTGTGTTTCACCCGACCGAACCGATTGTCGGGTCGTGCGGGAGTGACAAGCAGATTTACCTTGGGGAGATATGA
AA sequence
>Lus10003390 pacid=23175227 polypeptide=Lus10003390 locus=Lus10003390.g ID=Lus10003390.BGIv1.0 annot-version=v1.0
MKLEGHQDMVTGMQLSPDGSYLLTNGMDCKLCVWDMRPYAPQNWCLKVLEGHQQIFEKNLLKCSWSPDGIKVSAGTSDRMVYIWDTTSRRILYKLPEHTG
SVNECVFHPTEPIVGSCGSDKQIYLGEI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G43770 Transducin/WD40 repeat-like su... Lus10003390 0 1
Lus10023751 3.0 0.7605
AT1G75280 NmrA-like negative transcripti... Lus10042968 18.8 0.7150
AT2G03430 Ankyrin repeat family protein ... Lus10036968 25.0 0.6909
AT5G07990 CYP75B1, D501, ... TRANSPARENT TESTA 7, CYTOCHROM... Lus10017742 28.8 0.7199
AT4G15480 UGT84A1 UDP-Glycosyltransferase superf... Lus10002810 73.2 0.6401
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10018785 210.9 0.6228
AT2G15480 UGT73B5 UDP-glucosyl transferase 73B5 ... Lus10026926 268.3 0.6151

Lus10003390 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.