Lus10003393 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51780 171 / 2e-52 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G52060 102 / 1e-25 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT5G07220 87 / 4e-20 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT5G62100 86 / 8e-20 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G40630 51 / 7e-08 Ubiquitin-like superfamily protein (.1)
AT5G14360 50 / 2e-07 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002209 360 / 4e-126 AT3G51780 149 / 6e-43 BCL-2-associated athanogene 4 (.1)
Lus10027822 250 / 8e-83 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10005051 249 / 3e-81 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10027420 106 / 5e-27 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10023279 102 / 3e-26 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10038882 96 / 4e-23 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10015004 93 / 4e-22 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10005772 90 / 7e-21 AT5G52060 304 / 2e-102 BCL-2-associated athanogene 1 (.1)
Lus10006328 77 / 1e-16 AT5G52060 194 / 2e-60 BCL-2-associated athanogene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G121200 175 / 3e-54 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
Potri.001G279500 168 / 2e-51 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.009G074300 163 / 2e-49 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.012G133400 107 / 3e-27 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.015G135500 103 / 1e-25 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.001G358200 100 / 3e-25 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.001G110300 85 / 5e-19 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.003G121500 80 / 2e-17 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.001G339100 50 / 2e-07 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02179 BAG BAG domain
Representative CDS sequence
>Lus10003393 pacid=23175206 polypeptide=Lus10003393 locus=Lus10003393.g ID=Lus10003393.BGIv1.0 annot-version=v1.0
ATGATGACAGCGATGGCTCATCAGAATGAGGAGACGGAGTTGGAAGTGAGGCCTGGGGGAATGCTGGTACAAAGACGAGACGGCGATGATCGGCATCGCA
CTCACGGCGGGGGTTCTACTACAAACGTAATTAATGGAGCTCGAGCTCAGCACGATGTCCATATCCCTGCGCAATCTACTCTCGGCGAGTTGAAGAGGAT
CAATGAGCGCGACACAGGTCTGGAATGTGCTAGTAGGCACAAGATGTCATTCCGAGGAAAGGCGAAAGATGATGCTGAGCATGTGCACGATGCAGCCAAG
GAAAGAGAGGACGCATCAACAAAGCTGGATGTTAAGCAAATAGCTGAAATCTTGAAGGCAATGCAAGCTATTGATGAAGTTAGAACCAAAGTCGATAAGC
TCTCTGAAAGAGTCCATGCGCTTAAAGTTGCTGTTAATGGTGGAACGAAGGTGGCTGACCGGGAATTCGCAGTTGCAGCTGAGTTACTGATGAGGCAGTT
ACTGAAATTGGATACGATTGATGCCATAGGAGAAGCTAGGATTCAGCGGAAGGCTGAGGTGCTCAGAGTCCAGAAGTTGCACGCTTCGTTGGACGATCTG
AAGGCGAGGAATGGCAAGCCAGCAGATACAGGCTTTGTTGTCCCAACCGTGACGACCAACTGGGAAAAGTTTGACTCAGGAATGGGAAGCTTGACTCCTC
CACCTCCAGTGACTTCTTCAGCTACAATCACTCAGAACTAG
AA sequence
>Lus10003393 pacid=23175206 polypeptide=Lus10003393 locus=Lus10003393.g ID=Lus10003393.BGIv1.0 annot-version=v1.0
MMTAMAHQNEETELEVRPGGMLVQRRDGDDRHRTHGGGSTTNVINGARAQHDVHIPAQSTLGELKRINERDTGLECASRHKMSFRGKAKDDAEHVHDAAK
EREDASTKLDVKQIAEILKAMQAIDEVRTKVDKLSERVHALKVAVNGGTKVADREFAVAAELLMRQLLKLDTIDAIGEARIQRKAEVLRVQKLHASLDDL
KARNGKPADTGFVVPTVTTNWEKFDSGMGSLTPPPPVTSSATITQN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G51780 ATBAG4 BCL-2-associated athanogene 4 ... Lus10003393 0 1
AT4G29900 CIF1, ATACA10, ... COMPACT INFLORESCENCE 1, autoi... Lus10001638 2.0 0.9029
AT1G55620 CLCF, ATCLC-F, ... chloride channel F (.1.2) Lus10027138 2.0 0.8880
AT1G22610 C2 calcium/lipid-binding plant... Lus10009460 6.2 0.8861
AT2G20010 Protein of unknown function (D... Lus10012970 8.9 0.8624
Lus10022149 9.2 0.7829
Lus10030178 9.9 0.8164
AT1G06470 Nucleotide/sugar transporter f... Lus10031370 11.0 0.8265
AT5G47490 RGPR-related (.1) Lus10004721 14.5 0.8544
AT1G79570 Protein kinase superfamily pro... Lus10031173 15.5 0.8736
AT5G42710 unknown protein Lus10010806 15.8 0.8698

Lus10003393 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.