Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19770 86 / 3e-21 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19810 85 / 3e-20 ChiC class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19800 85 / 3e-20 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19820 75 / 9e-17 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19750 70 / 5e-15 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19760 69 / 1e-14 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19720 67 / 4e-14 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19730 61 / 1e-11 Glycosyl hydrolase superfamily protein (.1) AT4G19740 56 / 4e-10 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019061 [exp] 218 / 5e-68 AT4G21380 338 / 5e-104 receptor kinase 3 (.1) Lus10040021 [exp] 163 / 6e-49 AT4G19810 278 / 5e-89 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036306 [exp] 82 / 3e-19 AT4G19810 397 / 6e-138 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10000981 [exp] 76 / 1e-18 AT4G19810 74 / 2e-16 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10019060 [exp] 80 / 3e-18 AT4G19810 437 / 1e-149 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036311 [exp] 75 / 7e-17 AT4G19810 377 / 5e-130 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10017124 [exp] 67 / 1e-13 AT4G19810 260 / 9e-84 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036315 [exp] 65 / 4e-13 AT4G19820 253 / 3e-81 Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10018329 [exp] 64 / 6e-13 AT4G19810 268 / 1e-86 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G111900 [exp] 165 / 2e-48 AT3G16030 367 / 2e-114 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.018G111700 [exp] 139 / 2e-39 AT4G23200 363 / 1e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111800 [exp] 138 / 7e-39 AT4G23200 362 / 4e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111600 [exp] 104 / 4e-27 AT4G23180 377 / 2e-120 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.006G188400 [exp] 86 / 6e-21 AT4G19810 477 / 2e-169 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G188300 [exp] 85 / 2e-20 AT4G19810 379 / 2e-130 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G262001 [exp] 74 / 2e-16 AT4G19810 283 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G261800 [exp] 74 / 3e-16 AT4G19810 286 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112000 [exp] 73 / 6e-16 AT4G19810 284 / 3e-93 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112100 [exp] 69 / 1e-14 AT4G19810 279 / 3e-91 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00704 [flax] [poplar] Glyco_hydro_18 Glycosyl hydrolases family 18
Representative CDS sequence Show only first row Show all	>Lus10003408 pacid=23169611 polypeptide=Lus10003408 locus=Lus10003408.g ID=Lus10003408.BGIv1.0 annot-version=v1.0 ATGGCAGTTCCAATGTCTCCTAACCTGAATTCCGTCGGGTATCCAGTTCGATCCATGGTGAAGAATCTGGATTGGGCGAACCTGTTGGTCTACGATTACC ACTTGCCCACGAAGGAGAACTTCACGGCGAACCATGTCGCGTTATTCGACGATGATGATGGCGGCTCGACCGATTCGGGTATCAAGGAGTGGATTCGGGT CGGGTTTCCGGCGAAGAAGCTAGTTTTGGGACTACCGTACCACGGGTACGCGTGGAAGCTGGTGGATCCGAGGAACAACTCGCTGGGAGCTCCGAAGAAT GGGCCAGAGATGACGATTGCCGGGAACGTGGGATATAAACTGGTGAAATATACGATTGAGGGGTATGGGTATGGAGCTTGA
AA sequence Show only first row Show all	>Lus10003408 pacid=23169611 polypeptide=Lus10003408 locus=Lus10003408.g ID=Lus10003408.BGIv1.0 annot-version=v1.0 MAVPMSPNLNSVGYPVRSMVKNLDWANLLVYDYHLPTKENFTANHVALFDDDDGGSTDSGIKEWIRVGFPAKKLVLGLPYHGYAWKLVDPRNNSLGAPKN GPEMTIAGNVGYKLVKYTIEGYGYGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19770			Glycosyl hydrolase family prot...		Lus10003408 [exp]	0	1
AT2G20770		GCL2	GCR2-like 2 (.1)		Lus10031638 [exp]	1.0	0.9252
AT3G44160			Outer membrane OMP85 family pr...		Lus10004104 [exp]	5.5	0.9158
AT1G07360	C3HZnF	MAC5A	MOS4-associated complex subuni...		Lus10012448 [exp]	5.5	0.8466
AT1G06050			Protein of unknown function (D...		Lus10005308 [exp]	7.1	0.7053
AT5G48540			receptor-like protein kinase-r...		Lus10035754 [exp]	7.5	0.7980
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10004530 [exp]	9.3	0.8778
					Lus10008791 [exp]	10.8	0.8778
AT5G05220			unknown protein		Lus10029015 [exp]	10.8	0.6839
					Lus10021851 [exp]	12.0	0.8778
AT3G55210	NAC	ANAC063	NAC domain containing protein ...		Lus10031639 [exp]	13.0	0.8769

Compare expression of checked genes

Lus10003408 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.