Lus10003411 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10003411 pacid=23177879 polypeptide=Lus10003411 locus=Lus10003411.g ID=Lus10003411.BGIv1.0 annot-version=v1.0
ATGACTGATTCTTCTCCTCTGGGTTCTCTGCCAGAATTGCCTATTGTTACTAAAGATGTGAGGATAACTCTCGTTCCAGTCCAAGATGCTGATACGCCTC
CCAATTCTATTACTGTCCCGCCTACTCCCTCCCCAATGCCTAAAGAGTCCATCCCACTGATAGCTACCATGGTTTCTATTGCCCAGCGCATCAAGCAACA
TGTTGATGCCCTAGCCTCAACAGAAGATAATTCGGAAGGTATTTATGGGGTTGAATCAACAAGCAACAAGCTGCTGGGAAAGTCGAGGAAGAAACAACAG
CCGAAGAAAATGAGTAAGGTCAATCCGAATGGGACATATTTTGATCTTAATCATCCAGATATGCCAGAGGGAGCAATGGCTATTTCTCGGGTTTCAGAGA
CAGTTAATGAAGATATGGCACATTCTAGTCAGAGTTGA
AA sequence
>Lus10003411 pacid=23177879 polypeptide=Lus10003411 locus=Lus10003411.g ID=Lus10003411.BGIv1.0 annot-version=v1.0
MTDSSPLGSLPELPIVTKDVRITLVPVQDADTPPNSITVPPTPSPMPKESIPLIATMVSIAQRIKQHVDALASTEDNSEGIYGVESTSNKLLGKSRKKQQ
PKKMSKVNPNGTYFDLNHPDMPEGAMAISRVSETVNEDMAHSSQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003411 0 1
AT4G25300 2-oxoglutarate (2OG) and Fe(II... Lus10004581 3.3 0.9317
AT5G03810 GDSL-like Lipase/Acylhydrolase... Lus10040791 4.2 0.9109
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10021725 4.9 0.9103
AT3G22600 Bifunctional inhibitor/lipid-t... Lus10041197 5.3 0.9110
AT1G67070 PMI2, DIN9 PHOSPHOMANNOSE ISOMERASE 2, DA... Lus10028480 8.9 0.8818
AT4G26140 BGAL12 beta-galactosidase 12 (.1.2) Lus10028848 10.5 0.9015
AT2G37740 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) Lus10000705 11.0 0.8761
AT1G01580 FRD1, ATFRO2, F... FERRIC CHELATE REDUCTASE DEFEC... Lus10039268 11.5 0.8789
AT4G16970 Protein kinase superfamily pro... Lus10040153 11.8 0.8909
AT1G09812 unknown protein Lus10035787 12.2 0.8932

Lus10003411 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.