Lus10003414 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023790 79 / 4e-19 ND /
Lus10026843 68 / 1e-14 ND /
Lus10024537 68 / 1e-14 ND /
Lus10006891 64 / 4e-13 ND /
Lus10021601 51 / 4e-09 ND /
Lus10022121 48 / 8e-08 ND /
Lus10028090 40 / 0.0001 ND /
Lus10032813 39 / 0.0003 ND /
Lus10012415 0 / 1 AT2G25660 350 / 2e-106 embryo defective 2410 (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10003414 pacid=23177877 polypeptide=Lus10003414 locus=Lus10003414.g ID=Lus10003414.BGIv1.0 annot-version=v1.0
ATGGTGACAAAGATTCACAAGCCAATGCTTCGCCTCATCCACTTGTTTGCTCGTCACTGTATCTCGCACCACTCTTCTGCTTGCTCTTCCGATGCAATCA
CTAACCGAGACTTGTACATCGTCTACTGTTTGGAGAAGAAGATCGATATGCATTTGGGAGACTTGACTCCTCCAGTGAAGTGTGCGCCTCACGACTTATA
CCTGGAGGACTTGGAGAGGAATGGAGTGCTGCTCGATGAGGAGCTTGACACCATGACTCCAGGTCAGGGGTCCACTACTCAGGTTGCTGATGTGTCATCT
CTGCAGGCTGCCATGGAGCAGCTTGCTATCCTGCAACAGAGTTCAGATTAG
AA sequence
>Lus10003414 pacid=23177877 polypeptide=Lus10003414 locus=Lus10003414.g ID=Lus10003414.BGIv1.0 annot-version=v1.0
MVTKIHKPMLRLIHLFARHCISHHSSACSSDAITNRDLYIVYCLEKKIDMHLGDLTPPVKCAPHDLYLEDLERNGVLLDEELDTMTPGQGSTTQVADVSS
LQAAMEQLAILQQSSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003414 0 1

Lus10003414 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.