Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11340 71 / 2e-15 S-locus lectin protein kinase family protein (.1) AT3G12000 69 / 5e-15 S-locus related protein SLR1, putative (S1) (.1) AT1G65790 67 / 2e-14 ARK1 receptor kinase 1 (.1) AT1G65800 67 / 4e-14 ARK2 receptor kinase 2 (.1) AT5G39370 60 / 1e-12 Curculin-like (mannose-binding) lectin family protein (.1) AT4G21380 61 / 4e-12 ARK3 receptor kinase 3 (.1) AT1G11410 60 / 9e-12 S-locus lectin protein kinase family protein (.1) AT1G11300 58 / 4e-11 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT1G11330 56 / 2e-10 S-locus lectin protein kinase family protein (.1.2) AT1G11350 55 / 6e-10 SD1-13, RKS2, CBRLK1 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013910 [exp] 110 / 2e-29 AT1G11340 628 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10007604 [exp] 103 / 9e-27 AT1G11340 694 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10007610 [exp] 97 / 8e-25 AT1G11410 693 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10030768 [exp] 91 / 1e-22 AT1G11340 667 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013245 [exp] 91 / 1e-22 AT1G11300 955 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10005136 [exp] 91 / 1e-22 AT1G11340 471 / 2e-155 S-locus lectin protein kinase family protein (.1) Lus10013246 [exp] 90 / 3e-22 AT1G11340 678 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10034637 [exp] 90 / 3e-22 AT1G11340 660 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10030766 [exp] 90 / 3e-22 AT1G11340 660 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G028300 [exp] 101 / 2e-26 AT1G11340 742 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036532 [exp] 95 / 1e-24 AT1G11340 247 / 6e-75 S-locus lectin protein kinase family protein (.1) Potri.011G036600 [exp] 96 / 3e-24 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036100 [exp] 92 / 8e-23 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035800 [exp] 90 / 3e-22 AT1G11340 705 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036400 [exp] 90 / 3e-22 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028600 [exp] 86 / 1e-20 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028466 [exp] 86 / 1e-20 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028701 [exp] 85 / 1e-20 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035700 [exp] 82 / 1e-19 AT1G11340 743 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01453 [flax] [poplar] B_lectin D-mannose binding lectin
Representative CDS sequence Show only first row Show all	>Lus10003420 pacid=23164869 polypeptide=Lus10003420 locus=Lus10003420.g ID=Lus10003420.BGIv1.0 annot-version=v1.0 ATGCCTGACCAAACCGTTGTGTGGGTGGCAAATAGGAACAATCCCATTAATCCAACTACAGGGGTTCTTTTGATTCACGGGTATTGCAACCTTTTTCTCT ATAATAGTTGCAGTGACAAGGTTCTGGAGTGGTCCGCTAATGTTTCTGCAGGAATCGCCGGTCCTTGTGAGGCTCGGTTATTGGATACAGGGAATCTAGT TATGATGGTGTGTGTTACTACAACTAATACGACTATCGTGTGGCAAAGCTTTGATTATACTACAGACACACTGCGACTTGCTGAGAGAGTCGGGTTGAAT CGAAGACGTCGGTGA
AA sequence Show only first row Show all	>Lus10003420 pacid=23164869 polypeptide=Lus10003420 locus=Lus10003420.g ID=Lus10003420.BGIv1.0 annot-version=v1.0 MPDQTVVWVANRNNPINPTTGVLLIHGYCNLFLYNSCSDKVLEWSANVSAGIAGPCEARLLDTGNLVMMVCVTTTNTTIVWQSFDYTTDTLRLAERVGLN RRRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12000			S-locus related protein SLR1, ...		Lus10003420 [exp]	0	1
AT2G31420	B3		Domain of unknown function (DU...		Lus10027287 [exp]	3.5	0.7084
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10012494 [exp]	12.8	0.7654
					Lus10021816 [exp]	40.5	0.6989
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023037 [exp]	71.6	0.6494
					Lus10036058 [exp]	76.9	0.6493
AT5G10530			Concanavalin A-like lectin pro...		Lus10042310 [exp]	77.0	0.6590
AT1G11340			S-locus lectin protein kinase ...		Lus10018402 [exp]	78.5	0.6744
AT3G14770		SWEET2, AtSWEET...	Nodulin MtN3 family protein (....		Lus10002600 [exp]	81.7	0.6752
AT1G71530			Protein kinase superfamily pro...		Lus10009464 [exp]	85.7	0.6360
AT1G55520		ATTBP2, TBP2	A. THALIANA TATA BINDING PROTE...		Lus10017716 [exp]	100.2	0.6240

Compare expression of checked genes

Lus10003420 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.