Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22470 82 / 2e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63150 77 / 2e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63320 74 / 2e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12700 75 / 9e-17 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT1G63130 75 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62670 74 / 2e-16 RPF2 rna processing factor 2 (.1) AT1G12620 74 / 3e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62930 74 / 4e-16 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62680 72 / 1e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63080 71 / 2e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014247 [exp] 228 / 4e-73 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021074 [exp] 184 / 5e-58 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003447 [exp] 170 / 3e-51 AT1G12700 202 / 1e-56 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003429 [exp] 158 / 4e-49 AT1G62930 173 / 1e-49 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022861 [exp] 164 / 6e-49 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003446 [exp] 155 / 6e-49 AT1G62930 137 / 2e-37 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014244 [exp] 162 / 3e-48 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003433 [exp] 162 / 7e-48 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014245 [exp] 159 / 5e-47 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G117600 [exp] 127 / 1e-35 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G130600 [exp] 126 / 3e-35 AT1G12700 330 / 3e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G149800 [exp] 119 / 4e-32 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G038400 [exp] 118 / 6e-32 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050060 [exp] 107 / 3e-30 AT1G12700 146 / 8e-41 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050400 [exp] 112 / 1e-29 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046200 [exp] 111 / 1e-29 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G045000 [exp] 111 / 2e-29 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.019G021200 [exp] 109 / 8e-29 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050240 [exp] 109 / 9e-29 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10003426 pacid=23164886 polypeptide=Lus10003426 locus=Lus10003426.g ID=Lus10003426.BGIv1.0 annot-version=v1.0 ATGGAGAGCAGTAGGTTGAAGCCAAATATTGTCATCTATAATATTCTTATTGATAGCTTGTGGAAAGCAGGGAGGGTTAATGAAGCAAGGGTTATGTTTG CTAGGCTTTCTAAAGATGAGAGCTTACAGCTTGATGTCCCTACATACACTGTAGTAATGGATGGACAAGGTTCAGTAGATGAAGCATATGATTTGTTTAG AGCAATAGAGAGTAGTGGTTGTCTACATGATAATTGCTCTTATAATGTAATGGTCCATGGATTTCTTCGACATAAAGATCCACTTGAAGCAGTAGAGCTA ATTCAAGAGATGGTGAATAAGGGTTTCTCAGCTGATGCAGCCATTTCTCAGCTGATGCACCCACATTGGCCTCGCTGA
AA sequence Show only first row Show all	>Lus10003426 pacid=23164886 polypeptide=Lus10003426 locus=Lus10003426.g ID=Lus10003426.BGIv1.0 annot-version=v1.0 MESSRLKPNIVIYNILIDSLWKAGRVNEARVMFARLSKDESLQLDVPTYTVVMDGQGSVDEAYDLFRAIESSGCLHDNCSYNVMVHGFLRHKDPLEAVEL IQEMVNKGFSADAAISQLMHPHWPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22470			Pentatricopeptide repeat (PPR)...		Lus10003426 [exp]	0	1
AT4G37460		SRFR1	SUPPRESSOR OF RPS4-RLD 1, Tetr...		Lus10014863 [exp]	1.4	0.8979
AT5G02250		ATMTRNASEII, RN...	ribonucleotide reductase 1, EM...		Lus10010842 [exp]	4.2	0.8496
AT5G20320		DCL4, ATDCL4	dicer-like 4 (.1.2)		Lus10040013 [exp]	4.5	0.7930
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017819 [exp]	6.0	0.8005
AT3G01460		MBD9, ATMBD9	methyl-CPG-binding domain 9 (....		Lus10030624 [exp]	7.5	0.7781
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	9.2	0.8008
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10006596 [exp]	12.5	0.7899
AT1G56130			Leucine-rich repeat transmembr...		Lus10005375 [exp]	12.8	0.7264
AT3G49142			Tetratricopeptide repeat (TPR)...		Lus10027561 [exp]	13.7	0.7444
AT1G47270	TUB	AtTLP6	tubby like protein 6 (.1.2)		Lus10010833 [exp]	14.8	0.7448

Compare expression of checked genes

Lus10003426 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.