Lus10003442 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001031 218 / 2e-74 ND 38 / 8e-04
Lus10003443 152 / 2e-48 ND /
Lus10001030 112 / 1e-32 ND /
Lus10019332 97 / 1e-26 ND /
Lus10009372 56 / 2e-10 ND /
Lus10012129 53 / 2e-09 ND /
Lus10019334 52 / 4e-09 AT1G70690 40 / 2e-04 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Lus10012134 51 / 9e-09 AT5G40380 37 / 0.002 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1)
Lus10012132 49 / 4e-08 ND 38 / 0.001
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10003442 pacid=23164863 polypeptide=Lus10003442 locus=Lus10003442.g ID=Lus10003442.BGIv1.0 annot-version=v1.0
ATGATGTTACAATCATTAACAGCAGTGTTCTTCCTGGTAGCAATCATTCCGTGGTCTTGCGTGAACTCCATTGATGATCCATACTGTGATGGATTGCCTG
ACGGCGAATCCAGGTGCAATTCGGACCTGATCTCGCAGAATACTCAGAGAAGTCAAGATGACATATTGGACATCTTAAAGTCCGATGTCTTCTCTTACGA
AAAAGCCATCGCCTGTTACAATATTGATTCAACCAACGGTTATTTCTCTTGCAATCAGTTACGTGACGACTGCAAAACGTGTTATGATGCCGCCGTGGTA
AAGATGAAATATTGGTGTCCTGGTAGAGCTGGTGCAGCTGTCTCGTTGGAGCATTGTTGTCTAAGGTATGAGACTGCGTATCACTTTTGTCGTCCCATGT
GA
AA sequence
>Lus10003442 pacid=23164863 polypeptide=Lus10003442 locus=Lus10003442.g ID=Lus10003442.BGIv1.0 annot-version=v1.0
MMLQSLTAVFFLVAIIPWSCVNSIDDPYCDGLPDGESRCNSDLISQNTQRSQDDILDILKSDVFSYEKAIACYNIDSTNGYFSCNQLRDDCKTCYDAAVV
KMKYWCPGRAGAAVSLEHCCLRYETAYHFCRPM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003442 0 1
Lus10019938 3.5 0.7159
AT3G49700 AtACS9, ACS9, E... ETHYLENE OVERPRODUCING 3, 1-am... Lus10007249 4.7 0.7734
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10014586 8.0 0.7040
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10026419 11.4 0.6947
AT3G20800 Cell differentiation, Rcd1-lik... Lus10015136 12.7 0.7123
AT2G01050 zinc ion binding;nucleic acid ... Lus10032865 12.7 0.6787
AT1G63990 SPO11-2 sporulation 11-2 (.1) Lus10024675 12.7 0.6819
AT1G19250 FMO1 flavin-dependent monooxygenase... Lus10008454 13.5 0.6552
AT1G11940 Core-2/I-branching beta-1,6-N-... Lus10030027 17.5 0.6681
AT3G01140 MYB NOK, ATMYB106 NOECK, myb domain protein 106 ... Lus10030442 19.3 0.6658

Lus10003442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.