Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62930 136 / 2e-37 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63080 132 / 7e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62670 132 / 1e-35 RPF2 rna processing factor 2 (.1) AT1G12700 131 / 2e-35 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT1G63130 129 / 1e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62910 128 / 2e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63070 127 / 3e-34 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G63320 120 / 3e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63150 125 / 3e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62590 124 / 4e-33 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014247 [exp] 408 / 3e-142 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003433 [exp] 408 / 9e-142 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014242 [exp] 398 / 2e-140 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014245 [exp] 398 / 4e-138 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014244 [exp] 392 / 1e-135 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003429 [exp] 360 / 3e-127 AT1G62930 173 / 1e-49 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003447 [exp] 355 / 2e-121 AT1G12700 202 / 1e-56 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10021074 [exp] 287 / 4e-97 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022861 [exp] 266 / 1e-86 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G117600 [exp] 180 / 1e-54 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050060 [exp] 157 / 2e-48 AT1G12700 146 / 8e-41 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G257300 [exp] 166 / 3e-48 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074500 [exp] 164 / 7e-48 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050400 [exp] 163 / 3e-47 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G242500 [exp] 163 / 3e-47 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050180 [exp] 163 / 4e-47 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.019G021200 [exp] 162 / 4e-47 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046200 [exp] 162 / 5e-47 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G130600 [exp] 160 / 9e-47 AT1G12700 330 / 3e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10003446 pacid=23164861 polypeptide=Lus10003446 locus=Lus10003446.g ID=Lus10003446.BGIv1.0 annot-version=v1.0 ATGTGCCATCATGGACAGCTTCCGAATGTCGTGACATACAACAGTTTGCTTAATGGTTGGTGCAAAATAGGTCATCTGGACAAGGCATTAGCTCTATTCC AAGAAATAAAAAGTAGTCGGTTGAAGCCTGATGTTGTCATGTATACTATTCTTATTGACAGTTTGTGGAAAGCAGGAAGGGGTAAGGAAGCAAGGGACAT GTTTTCTGAGCTCTCTAAAGAAAGGGATTTACAACCTAATTCCTCCACATACAACACAGTAATTGATGGACTTTGTAGGCATGGTTTAGTAGATGAGGCA TATGATTTGTTTAGAACAATGGAGAGAAGCATATTCCCGCCAAATATTAGCACTTATAATGTGATCATCCATGGATTTCTTCGACATAAAGATCCACTTG AAGCAGTAGAGTTAATTCAAGAGATGGTGAATAAGGGCTTCTCAGCTGATGCAACCACATTGGCCTTGCTGATAGAATTGTTGCCCAAAAACCAGCTAGA TCATCCACTTTGGAGAAAGCTCCTAGGTGATTCTTATGTGGATAGAGAAGAGATTAGGTCTGAGGGTATATCAGCAGAGAAAACCTCAAAAGATTAG
AA sequence Show only first row Show all	>Lus10003446 pacid=23164861 polypeptide=Lus10003446 locus=Lus10003446.g ID=Lus10003446.BGIv1.0 annot-version=v1.0 MCHHGQLPNVVTYNSLLNGWCKIGHLDKALALFQEIKSSRLKPDVVMYTILIDSLWKAGRGKEARDMFSELSKERDLQPNSSTYNTVIDGLCRHGLVDEA YDLFRTMERSIFPPNISTYNVIIHGFLRHKDPLEAVELIQEMVNKGFSADATTLALLIELLPKNQLDHPLWRKLLGDSYVDREEIRSEGISAEKTSKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Lus10003446 [exp]	0	1
AT4G01830		ABCB5, PGP5	ATP-binding cassette B5, P-gly...		Lus10004518 [exp]	2.6	0.6795
AT3G01460		MBD9, ATMBD9	methyl-CPG-binding domain 9 (....		Lus10030624 [exp]	13.5	0.6576
AT1G49480	B3	REM19, RTV1	related to vernalization1 1 (....		Lus10009214 [exp]	30.2	0.6254
AT3G22470			Pentatricopeptide repeat (PPR)...		Lus10003426 [exp]	31.7	0.6253
AT5G01910			unknown protein		Lus10035364 [exp]	36.0	0.6136
AT3G12130	C3HZnF		KH domain-containing protein /...		Lus10012015 [exp]	38.9	0.5466
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017819 [exp]	40.8	0.6250
AT1G23850			unknown protein		Lus10030859 [exp]	50.5	0.5844
AT5G23200			unknown protein		Lus10017393 [exp]	51.9	0.5998
AT5G46460			Pentatricopeptide repeat (PPR)...		Lus10015256 [exp]	58.2	0.5916

Compare expression of checked genes

Lus10003446 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.