Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24020 39 / 5e-05 MLP423 MLP-like protein 423 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001033 [exp] 114 / 2e-34 AT1G24020 42 / 6e-05 MLP-like protein 423 (.1.2) Lus10003448 [exp] 110 / 1e-32 ND 36 / 0.005 Lus10001032 [exp] 106 / 4e-31 AT1G24020 44 / 1e-05 MLP-like protein 423 (.1.2) Lus10001042 [exp] 62 / 8e-14 AT1G24020 69 / 5e-15 MLP-like protein 423 (.1.2) Lus10003451 [exp] 62 / 1e-13 AT1G24020 73 / 7e-17 MLP-like protein 423 (.1.2) Lus10014241 [exp] 61 / 3e-13 AT1G24020 61 / 5e-12 MLP-like protein 423 (.1.2) Lus10000474 [exp] 61 / 3e-13 AT1G24020 64 / 2e-13 MLP-like protein 423 (.1.2) Lus10001037 [exp] 61 / 9e-13 AT1G24020 68 / 7e-14 MLP-like protein 423 (.1.2) Lus10001036 [exp] 61 / 9e-13 AT1G24020 68 / 2e-13 MLP-like protein 423 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G096000 [exp] 44 / 3e-07 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10003450 pacid=23164866 polypeptide=Lus10003450 locus=Lus10003450.g ID=Lus10003450.BGIv1.0 annot-version=v1.0 ATGAGTAGCGGAACAAAGACGGTGGCGTTTCAGATGCGTTCCTCAGCCAACGATGTGTGGAATTCCATCGTCGCCGCCCCGATCGTATTCCCTGCGGCGA TGCGTGATCTCTTTTCCAATATGGAACGTGTCATTGGTGACGGTGTAACCCAAGGCTCCATTCGGGACATCACTTTCGGAGTCGGTAAGTGA
AA sequence Show only first row Show all	>Lus10003450 pacid=23164866 polypeptide=Lus10003450 locus=Lus10003450.g ID=Lus10003450.BGIv1.0 annot-version=v1.0 MSSGTKTVAFQMRSSANDVWNSIVAAPIVFPAAMRDLFSNMERVIGDGVTQGSIRDITFGVGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003450 [exp]	0	1
					Lus10026417 [exp]	5.0	0.8861
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Lus10013136 [exp]	8.0	0.8447
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10013137 [exp]	9.2	0.8555
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10008100 [exp]	20.3	0.8486
AT2G02360		ATPP2-B10	phloem protein 2-B10 (.1)		Lus10003449 [exp]	22.9	0.8390
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10003451 [exp]	34.0	0.8305
					Lus10016424 [exp]	49.3	0.8084
AT1G78990			HXXXD-type acyl-transferase fa...		Lus10000557 [exp]	71.2	0.7990
					Lus10024257 [exp]	77.2	0.7434
AT1G66350	GRAS	RGL1	RGA-like 1 (.1)		Lus10037753 [exp]	91.6	0.7994

Compare expression of checked genes

Lus10003450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.