Lus10003452 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02100 107 / 6e-28 UDP-Glycosyltransferase superfamily protein (.1)
AT4G15500 103 / 2e-26 UGT84A4 UDP-Glycosyltransferase superfamily protein (.1)
AT1G78270 103 / 2e-26 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1)
AT1G05680 101 / 5e-26 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1)
AT4G15490 101 / 7e-26 UGT84A3 UDP-Glycosyltransferase superfamily protein (.1)
AT3G21560 101 / 9e-26 UGT84A2 UDP-Glycosyltransferase superfamily protein (.1)
AT1G05675 100 / 1e-25 UDP-Glycosyltransferase superfamily protein (.1)
AT1G05560 97 / 2e-24 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1)
AT2G31750 96 / 5e-24 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
AT3G46660 96 / 1e-23 UGT76E12 UDP-glucosyl transferase 76E12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015753 248 / 1e-81 AT3G02100 297 / 1e-95 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015750 225 / 5e-73 AT3G02100 298 / 2e-96 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015749 169 / 3e-51 AT3G02100 274 / 6e-87 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015748 157 / 8e-50 AT1G05680 121 / 6e-33 Uridine diphosphate glycosyltransferase 74E2 (.1)
Lus10015751 163 / 6e-49 AT3G02100 281 / 7e-90 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003455 159 / 4e-47 AT3G02100 291 / 1e-93 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003453 158 / 6e-47 AT3G02100 276 / 6e-88 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003454 157 / 1e-46 AT3G02100 268 / 1e-84 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015746 157 / 1e-46 AT3G02100 300 / 4e-97 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G084900 145 / 3e-42 AT3G02100 307 / 9e-100 UDP-Glycosyltransferase superfamily protein (.1)
Potri.004G119700 134 / 6e-38 AT3G02100 457 / 8e-159 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G091500 128 / 8e-36 AT3G02100 454 / 9e-158 UDP-Glycosyltransferase superfamily protein (.1)
Potri.004G123500 128 / 1e-35 AT3G02100 439 / 9e-152 UDP-Glycosyltransferase superfamily protein (.1)
Potri.013G022800 126 / 6e-35 AT3G02100 302 / 9e-98 UDP-Glycosyltransferase superfamily protein (.1)
Potri.015G071900 100 / 2e-25 AT1G24100 427 / 5e-147 UDP-glucosyl transferase 74B1 (.1)
Potri.002G236400 100 / 3e-25 AT1G05560 442 / 1e-152 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1)
Potri.014G146000 99 / 5e-25 AT4G15550 429 / 2e-147 indole-3-acetate beta-D-glucosyltransferase (.1)
Potri.016G020400 99 / 6e-25 AT1G22340 483 / 4e-168 UDP-glucosyl transferase 85A7 (.1)
Potri.006G055600 97 / 3e-24 AT4G15550 442 / 2e-152 indole-3-acetate beta-D-glucosyltransferase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10003452 pacid=23182472 polypeptide=Lus10003452 locus=Lus10003452.g ID=Lus10003452.BGIv1.0 annot-version=v1.0
ATGAAAAGGGTGGGGGATCTAGGCAAAATAGTGGCGTGGGGGAGTCAAGAGGAGGTGCTTTCGCACCCTTCGATTGCATGTTTCGTGAGCCATTGTGGGT
GGAACTCGACATTGGATGGATTGGTAGCCGGAGTTCCGCTCCTGTGCTGGCCTTTCTGTTTCGATCAGTTCCACAACAAGAAGTACATTTGTGAAACTTG
GAAGATTGGTTTGGAATTGAAGGCTGAAAATGGGACGGATGCAGGCATGATTTTGAAGACGGAGATTGTGAGGAAGATCGATGAGTTGGTTTATGATGAA
ACCATAAAATCCAATTCAATGAAGCTTAGGGAAATGGCTAGAGATACTACTCGTGGTAGTACTACTGATTATGCAGGGTCTTCATTCCTCAGGTTTGAAG
CATTTGTCACAGATCTTAACGGCCAAGAAGTATTTTGA
AA sequence
>Lus10003452 pacid=23182472 polypeptide=Lus10003452 locus=Lus10003452.g ID=Lus10003452.BGIv1.0 annot-version=v1.0
MKRVGDLGKIVAWGSQEEVLSHPSIACFVSHCGWNSTLDGLVAGVPLLCWPFCFDQFHNKKYICETWKIGLELKAENGTDAGMILKTEIVRKIDELVYDE
TIKSNSMKLREMARDTTRGSTTDYAGSSFLRFEAFVTDLNGQEVF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02100 UDP-Glycosyltransferase superf... Lus10003452 0 1
AT4G05120 FUR1, ENT3, FLU... FUDR RESISTANT 1, EQUILIBRATIV... Lus10018413 9.3 0.7322
AT3G58060 Cation efflux family protein (... Lus10029300 13.8 0.7214
Lus10018953 51.6 0.6995
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10029385 58.2 0.7080
AT3G60380 unknown protein Lus10028193 58.9 0.6804
Lus10015043 95.1 0.6938
AT3G02920 ATRPA32B Replication protein A, subunit... Lus10015505 97.1 0.6443
AT3G55500 ATHEXPALPHA1.7,... EXPANSIN 16, expansin A16 (.1) Lus10023901 103.3 0.6828
AT5G16990 Zinc-binding dehydrogenase fam... Lus10007853 104.0 0.6705
Lus10038978 110.1 0.6879

Lus10003452 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.