Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02100 69 / 5e-15 UDP-Glycosyltransferase superfamily protein (.1) AT2G36970 67 / 2e-14 UDP-Glycosyltransferase superfamily protein (.1) AT1G78270 64 / 4e-13 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1) AT1G22370 59 / 1e-11 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2) AT3G22250 59 / 2e-11 UDP-Glycosyltransferase superfamily protein (.1) AT1G22340 58 / 3e-11 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G22400 57 / 6e-11 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) AT1G22380 57 / 9e-11 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22360 56 / 3e-10 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT2G31790 49 / 6e-08 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015746 [exp] 170 / 2e-52 AT3G02100 300 / 4e-97 UDP-Glycosyltransferase superfamily protein (.1) Lus10015745 [exp] 117 / 2e-32 AT3G02100 288 / 1e-92 UDP-Glycosyltransferase superfamily protein (.1) Lus10015744 [exp] 83 / 6e-20 AT3G02100 271 / 6e-86 UDP-Glycosyltransferase superfamily protein (.1) Lus10015749 [exp] 83 / 8e-20 AT3G02100 274 / 6e-87 UDP-Glycosyltransferase superfamily protein (.1) Lus10003453 [exp] 82 / 9e-20 AT3G02100 276 / 6e-88 UDP-Glycosyltransferase superfamily protein (.1) Lus10000309 [exp] 80 / 4e-19 AT3G02100 152 / 1e-42 UDP-Glycosyltransferase superfamily protein (.1) Lus10003454 [exp] 79 / 1e-18 AT3G02100 268 / 1e-84 UDP-Glycosyltransferase superfamily protein (.1) Lus10003455 [exp] 76 / 1e-17 AT3G02100 291 / 1e-93 UDP-Glycosyltransferase superfamily protein (.1) Lus10015751 [exp] 75 / 6e-17 AT3G02100 281 / 7e-90 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G091500 [exp] 71 / 1e-15 AT3G02100 454 / 9e-158 UDP-Glycosyltransferase superfamily protein (.1) Potri.016G019400 [exp] 66 / 6e-14 AT3G22250 494 / 3e-173 UDP-Glycosyltransferase superfamily protein (.1) Potri.004G123500 [exp] 66 / 9e-14 AT3G02100 439 / 9e-152 UDP-Glycosyltransferase superfamily protein (.1) Potri.005G073766 [exp] 63 / 6e-13 AT1G22400 562 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.005G073800 [exp] 63 / 6e-13 AT1G22400 562 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.017G052232 [exp] 62 / 1e-12 AT1G22360 622 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G051900 [exp] 58 / 1e-12 AT1G78270 92 / 8e-24 UDP-glucosyl transferase 85A4 (.1) Potri.017G052000 [exp] 61 / 2e-12 AT1G22360 617 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052100 [exp] 61 / 2e-12 AT1G22360 612 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052400 [exp] 61 / 2e-12 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003456 pacid=23182480 polypeptide=Lus10003456 locus=Lus10003456.g ID=Lus10003456.BGIv1.0 annot-version=v1.0 ATGGCGGCAACGAAGAAGCCTCATGTTCTTCTAGTGCCATACCCAGCGCAAGGCCACGTTATTCCGATGCTTAAGCTAGCACAGAAGCTAGCAGACCATG GATTCACTATCACGGTCGTTAATTTCGAGTTTGTCCACGAAAAGCTTGTTTCGTCTCCTGAGCATCAAAGCGTCAGGCTCACTGCAATTCCCTTCGAGTT GGAACCCGGGTTGGGGCAAGATGATGCAGCGGCCAAGTTGACAGAGAGCATAGCAAATGAGCTGCCAAATTCACTTGCGGGGTCTAATTGA
AA sequence Show only first row Show all	>Lus10003456 pacid=23182480 polypeptide=Lus10003456 locus=Lus10003456.g ID=Lus10003456.BGIv1.0 annot-version=v1.0 MAATKKPHVLLVPYPAQGHVIPMLKLAQKLADHGFTITVVNFEFVHEKLVSSPEHQSVRLTAIPFELEPGLGQDDAAAKLTESIANELPNSLAGSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	0	1
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	1.0	1.0000
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	2.0	1.0000
AT5G09360		LAC14	laccase 14 (.1)		Lus10026812 [exp]	2.6	0.9579
AT3G14470			NB-ARC domain-containing disea...		Lus10032781 [exp]	2.8	0.9417
AT2G04810			Protein of unknown function (D...		Lus10020538 [exp]	3.0	0.9979
AT4G16270			Peroxidase superfamily protein...		Lus10017069 [exp]	3.2	0.9711
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10021213 [exp]	3.5	0.9963
AT3G44220			Late embryogenesis abundant (L...		Lus10005214 [exp]	4.2	0.9695
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10006697 [exp]	4.2	0.8836
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028003 [exp]	5.5	0.9197

Compare expression of checked genes

Lus10003456 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.