Lus10003457 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02100 92 / 2e-22 UDP-Glycosyltransferase superfamily protein (.1)
AT3G16520 63 / 5e-12 UGT88A1 UDP-glucosyl transferase 88A1 (.1.2.3)
AT1G22360 61 / 2e-11 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2)
AT2G23250 61 / 2e-11 UGT84B2 UDP-glucosyl transferase 84B2 (.1)
AT2G31790 58 / 3e-10 UDP-Glycosyltransferase superfamily protein (.1)
AT2G23260 58 / 3e-10 UGT84B1 UDP-glucosyl transferase 84B1 (.1)
AT4G01070 58 / 4e-10 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
AT3G21800 58 / 4e-10 UGT71B8 UDP-glucosyl transferase 71B8 (.1)
AT1G22370 57 / 6e-10 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2)
AT1G01390 57 / 6e-10 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015744 279 / 2e-93 AT3G02100 271 / 6e-86 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015746 220 / 1e-70 AT3G02100 300 / 4e-97 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015745 218 / 1e-69 AT3G02100 288 / 1e-92 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003455 217 / 2e-69 AT3G02100 291 / 1e-93 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015749 215 / 2e-68 AT3G02100 274 / 6e-87 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015752 211 / 2e-68 AT3G02100 141 / 3e-38 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003453 211 / 3e-67 AT3G02100 276 / 6e-88 UDP-Glycosyltransferase superfamily protein (.1)
Lus10015751 210 / 2e-66 AT3G02100 281 / 7e-90 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003454 203 / 6e-64 AT3G02100 268 / 1e-84 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G123500 111 / 4e-29 AT3G02100 439 / 9e-152 UDP-Glycosyltransferase superfamily protein (.1)
Potri.004G119700 110 / 1e-28 AT3G02100 457 / 8e-159 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G091500 101 / 1e-25 AT3G02100 454 / 9e-158 UDP-Glycosyltransferase superfamily protein (.1)
Potri.013G022800 84 / 2e-19 AT3G02100 302 / 9e-98 UDP-Glycosyltransferase superfamily protein (.1)
Potri.010G084900 84 / 4e-19 AT3G02100 307 / 9e-100 UDP-Glycosyltransferase superfamily protein (.1)
Potri.007G049600 66 / 5e-13 AT2G23260 422 / 1e-144 UDP-glucosyl transferase 84B1 (.1)
Potri.016G105300 66 / 5e-13 AT1G22380 327 / 8e-107 UDP-glucosyl transferase 85A3 (.1)
Potri.016G105400 66 / 5e-13 AT1G22380 324 / 6e-106 UDP-glucosyl transferase 85A3 (.1)
Potri.014G096100 65 / 1e-12 AT4G01070 610 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Potri.016G020700 64 / 3e-12 AT1G22360 364 / 4e-123 UDP-glucosyl transferase 85A2 (.1.2)
PFAM info
Representative CDS sequence
>Lus10003457 pacid=23182495 polypeptide=Lus10003457 locus=Lus10003457.g ID=Lus10003457.BGIv1.0 annot-version=v1.0
ATGGAGAGCTTGGCTTTGATGTTGCTCATTCCTCAGCTGATCCAGGATGGGACTATAGACGAAAACGGATCTTTAATAAACAAAGACCTGCCGGTTTCCC
TGTGTCAAGAAATCCCATCCTGGAAAGCAAACGAATTACCATGGAGCTGTCAACCTGACGAAATTCAAACGTTCATTTTCAGACGTTACTACGTGAACCC
AGCAGAGTACTATGCATTGTTCGACTGCTTCATCGTCAACTCGTTCCGCGAACTTGAGAATTCAGCTTTCGAATTGTACCACGACATCCTCCCAATAGGT
CCACTGGTCACAAATTCCACTACTTCAGGAAAATTCCACAACCTAGGAAGCTTCTGGCGTCAGGATGAAACTTGCTCGACCTGGCTCGACAAACATCCTC
TGAGGTCAGTCATATACGTTGCGTTCGGAAGCATCGTGGACCTGAACTCGCGACAATTCCAGGAGCTAGCAATGGGTCTTGAAATGACAGAAAACCTTTC
CTCTGGGTAG
AA sequence
>Lus10003457 pacid=23182495 polypeptide=Lus10003457 locus=Lus10003457.g ID=Lus10003457.BGIv1.0 annot-version=v1.0
MESLALMLLIPQLIQDGTIDENGSLINKDLPVSLCQEIPSWKANELPWSCQPDEIQTFIFRRYYVNPAEYYALFDCFIVNSFRELENSAFELYHDILPIG
PLVTNSTTSGKFHNLGSFWRQDETCSTWLDKHPLRSVIYVAFGSIVDLNSRQFQELAMGLEMTENLSSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02100 UDP-Glycosyltransferase superf... Lus10003457 0 1
AT4G09960 MADS AGL11, STK SEEDSTICK, AGAMOUS-like 11, K-... Lus10009481 6.3 0.8970
AT1G70580 GGT2, AOAT2 GLUTAMATE:GLYOXYLATE AMINOTRAN... Lus10006203 14.1 0.8998
AT2G28260 ATCNGC15 cyclic nucleotide-gated channe... Lus10016097 19.7 0.8600
AT2G13620 ATCHX15 CATION/H+ EXCHANGER 15, cation... Lus10040881 26.6 0.8905
AT5G53980 HD ATHB52 homeobox protein 52 (.1) Lus10003492 26.7 0.8474
Lus10030905 27.4 0.8532
AT3G04970 DHHC-type zinc finger family p... Lus10004149 30.4 0.8487
Lus10007097 31.2 0.8746
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013924 32.6 0.8792
AT5G64440 ATFAAH fatty acid amide hydrolase (.1... Lus10020469 39.7 0.8714

Lus10003457 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.