Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27410 65 / 2e-12 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT3G15500 64 / 4e-12 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT1G52890 64 / 6e-12 NAC ANAC019 NAC domain containing protein 19 (.1) AT5G62380 63 / 1e-11 NAC ANAC101, VND6 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) AT4G36160 62 / 3e-11 NAC ANAC076, VND2 VASCULAR-RELATED NAC-DOMAIN 2, NAC domain containing protein 76 (.1) AT5G63790 59 / 4e-10 NAC ANAC102 NAC domain containing protein 102 (.1) AT3G29035 58 / 5e-10 NAC ORS1, AtNAC3, ANAC059 ORE1 SISTER1, Arabidopsis NAC domain containing protein 59, NAC domain containing protein 3 (.1) AT3G12910 58 / 7e-10 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G01720 57 / 8e-10 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G18400 57 / 1e-09 NAC ANAC058 NAC domain containing protein 58 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015743 [exp] 333 / 6e-118 AT3G12910 60 / 9e-11 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10034700 [exp] 92 / 5e-23 AT3G18400 76 / 2e-16 NAC domain containing protein 58 (.1) Lus10041822 [exp] 64 / 5e-12 AT2G18060 352 / 3e-120 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1) Lus10028372 [exp] 64 / 5e-12 AT2G18060 349 / 4e-119 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1) Lus10020883 [exp] 62 / 2e-11 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10033493 [exp] 62 / 4e-11 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10025690 [exp] 61 / 8e-11 AT1G01720 405 / 1e-143 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10018142 [exp] 60 / 1e-10 AT1G01720 401 / 7e-142 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10036117 [exp] 59 / 3e-10 AT3G15510 241 / 2e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G404100 [exp] 65 / 2e-12 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.005G069500 [exp] 62 / 2e-11 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.011G123300 [exp] 62 / 2e-11 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.007G099400 [exp] 60 / 9e-11 AT1G01720 366 / 6e-128 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G205400 [exp] 60 / 1e-10 AT2G43000 269 / 6e-90 NAC domain containing protein 42 (.1) Potri.007G014400 [exp] 59 / 3e-10 AT2G18060 427 / 1e-149 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1) Potri.019G083600 [exp] 59 / 3e-10 AT1G71930 320 / 4e-109 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) Potri.012G038100 [exp] 59 / 4e-10 AT3G17730 339 / 4e-118 NAC domain containing protein 57 (.1) Potri.001G144400 [exp] 58 / 8e-10 AT4G17980 318 / 2e-108 NAC domain containing protein 71 (.1) Potri.005G116800 [exp] 57 / 2e-09 AT2G18060 441 / 2e-155 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10003458 pacid=23182490 polypeptide=Lus10003458 locus=Lus10003458.g ID=Lus10003458.BGIv1.0 annot-version=v1.0 ATGATGAATTCTTCTGTGCTGTCAAATGGCGGAGAAGGAAGAAGACGACTGCTGCTAGTGTCGTCGGAAGAGACGGAGGTTGCCAAGACGTTCCCGCTTG GGTACAGGTTCAAGCCCACCGACCGCGAATTGGTGAAGCATTACTTGATCCCCAAATCCATGGGTTTTGAATCGGATTCTGCGTTTTTTGGCTGTATTGG CAATACTATGAACGCCTCTGATTTCTTTGCTCTGCCACCGTATGATCTTGTGTCTCCGATCGCCAAAAAAGAGGAGTGGTATGTGTTCATTCACCAAGAC CAACAGAGTAATGGAACTCAGTCAAATGAAGACACCAAACAAGGTGACGACGACGGCGACAAACTGACGGTGACAAGAACAGTGAATGGAGAAGGATTCT GGAAATCAAACAAGAGCTTCGACCTGACAATTTGTGACCACTCCTCTGGATTGCCGCTAGGCTTCAAGTCTCGGTTCACTTACTATTTGTCTTCTTCCAC CCGCGGCACACTGGAAACTGAATGGAAACTCGACGAGTATCGCCTCTTTAGCCCTCCAAATCCCAAGGGATATACCCTACTGAATCTCATGCCACACGAG GATCAGAACAAGTACACCAGTAATTGGCAGTTTCATGGCGGCTAA
AA sequence Show only first row Show all	>Lus10003458 pacid=23182490 polypeptide=Lus10003458 locus=Lus10003458.g ID=Lus10003458.BGIv1.0 annot-version=v1.0 MMNSSVLSNGGEGRRRLLLVSSEETEVAKTFPLGYRFKPTDRELVKHYLIPKSMGFESDSAFFGCIGNTMNASDFFALPPYDLVSPIAKKEEWYVFIHQD QQSNGTQSNEDTKQGDDDGDKLTVTRTVNGEGFWKSNKSFDLTICDHSSGLPLGFKSRFTYYLSSSTRGTLETEWKLDEYRLFSPPNPKGYTLLNLMPHE DQNKYTSNWQFHGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27410	NAC	RD26, ANAC072	NAC (No Apical Meristem) domai...		Lus10003458 [exp]	0	1
AT1G33540		SCPL18	serine carboxypeptidase-like 1...		Lus10011710 [exp]	1.0	0.8402
AT1G24625	C2H2ZnF	ZFP7	zinc finger protein 7 (.1)		Lus10043380 [exp]	1.4	0.8021
					Lus10030838 [exp]	3.0	0.7601
AT1G63320			Pentatricopeptide repeat (PPR)...		Lus10009331 [exp]	4.0	0.7513
					Lus10020530 [exp]	6.9	0.7367
AT4G18340			Glycosyl hydrolase superfamily...		Lus10031034 [exp]	13.6	0.7481
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	14.7	0.7481
					Lus10027667 [exp]	15.7	0.7481
					Lus10015682 [exp]	16.7	0.7481
					Lus10004853 [exp]	17.6	0.7481

Compare expression of checked genes

Lus10003458 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.