Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06620 222 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G04380 219 / 2e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43440 218 / 1e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G06650 218 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G04350 217 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G03410 217 / 7e-70 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06640 214 / 3e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT5G43450 213 / 9e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59530 213 / 9e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G61400 213 / 1e-68 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022191 [exp] 308 / 5e-106 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022192 [exp] 298 / 3e-102 AT5G43440 372 / 1e-128 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10021943 [exp] 224 / 5e-73 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10041230 [exp] 214 / 3e-71 AT5G59530 270 / 1e-90 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022193 [exp] 219 / 8e-71 AT1G06620 455 / 1e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027586 [exp] 216 / 9e-70 AT1G06620 449 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037796 [exp] 213 / 6e-69 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10017080 [exp] 213 / 1e-68 AT1G06620 440 / 3e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10001103 [exp] 209 / 3e-67 AT1G06620 427 / 2e-149 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G073166 [exp] 227 / 3e-74 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073300 [exp] 218 / 8e-71 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073100 [exp] 208 / 1e-66 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.008G165400 [exp] 204 / 6e-65 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073232 [exp] 203 / 8e-65 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G156200 [exp] 196 / 3e-62 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.013G045000 [exp] 194 / 4e-61 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G135800 [exp] 188 / 7e-59 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G222300 [exp] 184 / 2e-57 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G136000 [exp] 172 / 6e-53 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10003459 pacid=23182483 polypeptide=Lus10003459 locus=Lus10003459.g ID=Lus10003459.BGIv1.0 annot-version=v1.0 ATGGTGCACATGGGTCACTTGATCTTTGAGCTCTTGTCGGAGGCTCTAGGTCTTGAACCAAATTACTTGAGAAACAAAGACTGCTTGATGGGACACAGCT TTGTGTGTCATTACTACCCACCATGTCCTCAACCAGACCAAACTTTGGGAGCAAGCAAGCACACAGATACTGACTTCATGACCATTCTCTCACAAGATCA TGTCGGTGGCCTGCAAGTTCTTCATCAAGTTGAGTGGGTTGACGTGCCCCCGTTGCCCGGATCTCTAGTCATCAACGTCGGGGATCTTTTGCAGTTGATG TCGAACGACAAATTGCGAAGCGTGGAGCACAGGGTTTTGGCCAATCGCAGTACTGAACCCAGGATATCCGTCGCGTGCTTCTTCAGTACTGGCCTTGTAC CAAATCTCAGAAAGTATGAACCAATTCAAGAGCTCTTATCTGAAGAGAATCCCCCCAAGTACATGGCTACTACTGTTTCTGAATTTGTCACCTATGTCAC CCGAAAAATCTTCTCTCCACCATTTGAAGCTCTAAATCATTGA
AA sequence Show only first row Show all	>Lus10003459 pacid=23182483 polypeptide=Lus10003459 locus=Lus10003459.g ID=Lus10003459.BGIv1.0 annot-version=v1.0 MVHMGHLIFELLSEALGLEPNYLRNKDCLMGHSFVCHYYPPCPQPDQTLGASKHTDTDFMTILSQDHVGGLQVLHQVEWVDVPPLPGSLVINVGDLLQLM SNDKLRSVEHRVLANRSTEPRISVACFFSTGLVPNLRKYEPIQELLSEENPPKYMATTVSEFVTYVTRKIFSPPFEALNH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10003459 [exp]	0	1
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10040115 [exp]	2.8	0.8512
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10033385 [exp]	3.5	0.8794
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006700 [exp]	7.1	0.8563
					Lus10003479 [exp]	7.9	0.8124
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10023160 [exp]	14.9	0.8352
					Lus10024012 [exp]	16.2	0.7772
					Lus10019512 [exp]	16.3	0.7660
					Lus10015043 [exp]	16.9	0.7780
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10017826 [exp]	18.5	0.8158
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10007853 [exp]	22.4	0.7691

Compare expression of checked genes

Lus10003459 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.