Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61220 104 / 6e-31 LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021653 [exp] 168 / 6e-56 AT5G61220 105 / 4e-31 LYR family of Fe/S cluster biogenesis protein (.1) Lus10034706 [exp] 166 / 3e-55 AT5G61220 104 / 5e-31 LYR family of Fe/S cluster biogenesis protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G079800 [exp] 147 / 1e-47 AT5G61220 97 / 7e-28 LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0491 [flax] [poplar] LYR-like PF05347 [flax] [poplar] Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence Show only first row Show all	>Lus10003467 pacid=23182477 polypeptide=Lus10003467 locus=Lus10003467.g ID=Lus10003467.BGIv1.0 annot-version=v1.0 ATGGCGTCGACCACCGTCTCAAGAGGCGAAATCCTCTCCCTTTGCCGTTCCCTCCTCCGTACAGCTCGACAGTTCAGCGACTACAACATTCGTGAGTACA CCAAGCTGCGGACCGTCGACGGATTCCGGCAGAACCAGGGGCTAACCGAACCGTTCTCCATCTCCGCTGCATACTCCGACGGGAAATCTCAGCTGGAAGT TGCCAAGAGGCAAGCTGTTGTTTACTCGCTTTACGCCCCTACAATCAAGAGCGTGATGGAGACCGACTTGAAAGGCAAACGCTGA
AA sequence Show only first row Show all	>Lus10003467 pacid=23182477 polypeptide=Lus10003467 locus=Lus10003467.g ID=Lus10003467.BGIv1.0 annot-version=v1.0 MASTTVSRGEILSLCRSLLRTARQFSDYNIREYTKLRTVDGFRQNQGLTEPFSISAAYSDGKSQLEVAKRQAVVYSLYAPTIKSVMETDLKGKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G61220			LYR family of Fe/S cluster bio...		Lus10003467 [exp]	0	1
AT5G07740			actin binding (.1)		Lus10015725 [exp]	10.0	0.7328
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10031175 [exp]	24.5	0.7085
AT1G02816			Protein of unknown function, D...		Lus10009855 [exp]	28.8	0.6507
AT3G26580			Tetratricopeptide repeat (TPR)...		Lus10006208 [exp]	29.2	0.6793
AT3G26310		CYP71B35	"cytochrome P450, family 71, s...		Lus10006443 [exp]	38.3	0.6866
AT5G22260		MS1	male sterility 1, RING/FYVE/PH...		Lus10030773 [exp]	38.7	0.6758
AT1G70630			Nucleotide-diphospho-sugar tra...		Lus10036860 [exp]	39.9	0.6892
					Lus10032429 [exp]	39.9	0.6457
AT5G62380	NAC	ANAC101, VND6	VASCULAR-RELATED NAC-DOMAIN 6,...		Lus10009858 [exp]	42.2	0.6668
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10023640 [exp]	42.3	0.6790

Compare expression of checked genes

Lus10003467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.