Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74360 148 / 1e-42 Leucine-rich repeat protein kinase family protein (.1) AT5G49660 90 / 6e-22 XIP1 XYLEM INTERMIXED WITH PHLOEM 1, Leucine-rich repeat transmembrane protein kinase family protein (.1) AT1G55610 90 / 6e-22 BRL1 BRI1 like (.1.2) AT3G13380 89 / 1e-21 BRL3 BRI1-like 3 (.1) AT5G07280 84 / 1e-19 EXS, EMS1 EXTRA SPOROGENOUS CELLS, EXCESS MICROSPOROCYTES1, Leucine-rich repeat transmembrane protein kinase (.1) AT1G09970 82 / 5e-19 RLK7, LRRXI-23 ,LRR XI-23 receptor-like kinase 7, Leucine-rich receptor-like protein kinase family protein (.1.2) AT5G61480 81 / 6e-19 PXY, TDR TDIF receptor, PHLOEM INTERCALATED WITH XYLEM, Leucine-rich repeat protein kinase family protein (.1) AT1G08590 80 / 2e-18 Leucine-rich receptor-like protein kinase family protein (.1) AT4G28650 80 / 2e-18 Leucine-rich repeat transmembrane protein kinase family protein (.1) AT3G09010 79 / 3e-18 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015729 [exp] 106 / 8e-28 AT1G74360 539 / 2e-173 Leucine-rich repeat protein kinase family protein (.1) Lus10007233 [exp] 93 / 6e-23 AT5G49660 1224 / 0.0 XYLEM INTERMIXED WITH PHLOEM 1, Leucine-rich repeat transmembrane protein kinase family protein (.1) Lus10028234 [exp] 92 / 2e-22 AT5G49660 1234 / 0.0 XYLEM INTERMIXED WITH PHLOEM 1, Leucine-rich repeat transmembrane protein kinase family protein (.1) Lus10005491 [exp] 91 / 3e-22 AT5G25930 1104 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Lus10014996 [exp] 87 / 5e-21 AT5G07280 1264 / 0.0 EXTRA SPOROGENOUS CELLS, EXCESS MICROSPOROCYTES1, Leucine-rich repeat transmembrane protein kinase (.1) Lus10006028 [exp] 87 / 6e-21 AT5G25930 1116 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Lus10012462 [exp] 86 / 1e-20 AT1G09970 391 / 2e-128 receptor-like kinase 7, Leucine-rich receptor-like protein kinase family protein (.1.2) Lus10020500 [exp] 86 / 3e-20 AT1G09970 755 / 0.0 receptor-like kinase 7, Leucine-rich receptor-like protein kinase family protein (.1.2) Lus10028232 [exp] 84 / 6e-20 AT1G09970 1181 / 0.0 receptor-like kinase 7, Leucine-rich receptor-like protein kinase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G061600 [exp] 147 / 4e-42 AT1G74360 1375 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.012G067600 [exp] 144 / 3e-41 AT1G74360 1014 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.018G088086 [exp] 91 / 8e-24 AT5G25930 227 / 1e-69 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.001G472900 [exp] 92 / 8e-23 AT1G55610 1485 / 0.0 BRI1 like (.1.2) Potri.018G088100 [exp] 92 / 1e-22 AT5G25930 949 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.011G169600 [exp] 91 / 2e-22 AT1G55610 1500 / 0.0 BRI1 like (.1.2) Potri.018G088062 [exp] 90 / 5e-22 AT5G25930 949 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.018G088200 [exp] 88 / 2e-21 AT5G25930 885 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.002G111700 [exp] 87 / 4e-21 AT5G49660 1229 / 0.0 XYLEM INTERMIXED WITH PHLOEM 1, Leucine-rich repeat transmembrane protein kinase family protein (.1) Potri.006G235450 [exp] 83 / 2e-20 AT5G25930 268 / 9e-84 Protein kinase family protein with leucine-rich repeat domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10003477 pacid=23182479 polypeptide=Lus10003477 locus=Lus10003477.g ID=Lus10003477.BGIv1.0 annot-version=v1.0 ATGGTGGCGGGAACGGTGGGATACGTGGCGCCTGAGTACGGGCAGACGTGGCAGGCGACAACGAAGGGGGATGTGTACAGCTATGGTGTGTTGTTGATGG AATTGGCCACGGGGAGGAGGGCGGTGGACGGAGGGGAGGACGAGTGTTTGGTTGAGTGGGCGAGGAGGGTGATGGGCGGCGGCGGAAGAGAAAGAGGGTT GGTGCCGGCGGTGGTTATGGGATCGGATGGAGCGGCGGAGATGAGTGAGCTGTTGAGGATAGGGGTGAGGTGTACGGCGGAGGCGCCACAAGTGAGACCT AACATGAAGGAGGTACTGGGGATGTTGGTTAAGATGCTTTCCGGCGGCGACCTACCTCCGCCGCGGTGA
AA sequence Show only first row Show all	>Lus10003477 pacid=23182479 polypeptide=Lus10003477 locus=Lus10003477.g ID=Lus10003477.BGIv1.0 annot-version=v1.0 MVAGTVGYVAPEYGQTWQATTKGDVYSYGVLLMELATGRRAVDGGEDECLVEWARRVMGGGGRERGLVPAVVMGSDGAAEMSELLRIGVRCTAEAPQVRP NMKEVLGMLVKMLSGGDLPPPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74360			Leucine-rich repeat protein ki...		Lus10003477 [exp]	0	1
AT2G15760			Protein of unknown function (D...		Lus10014025 [exp]	6.5	0.9656
AT4G36990	HSF	AT-HSFB1, ATHSF...	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10019348 [exp]	8.5	0.9653
AT4G06536			SPla/RYanodine receptor (SPRY)...		Lus10018730 [exp]	10.6	0.9674
AT4G24690		AtNBR1	Arabidopsis thaliana next to B...		Lus10017950 [exp]	10.8	0.9586
AT1G65520		PEC11, ECHIC, A...	"delta\(3\), delta\(2\)-enoyl ...		Lus10001701 [exp]	13.1	0.9299
AT1G25370			Protein of unknown function (D...		Lus10038942 [exp]	14.1	0.9397
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003266 [exp]	14.3	0.9466
AT3G15518			unknown protein		Lus10043096 [exp]	15.0	0.9505
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Lus10042557 [exp]	18.1	0.9382
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Lus10005746 [exp]	18.6	0.9296

Compare expression of checked genes

Lus10003477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.