Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003493 pacid=23156263 polypeptide=Lus10003493 locus=Lus10003493.g ID=Lus10003493.BGIv1.0 annot-version=v1.0 ATGGGAGCTAGCATCGTCTTCCATGGTCGATTCATTCCACTTGGCATTGAGGACAATGCCCCTGGTTTAGGGGGAGTAATGGATCGCCAACAATTGCTTG CAAATTTGATCCTGAGCCAATCCAATCTTGGCACTTTCGCATTCCTCTCGAAGCTATGCTTGGGGCTTCTGTTGCTGCTCTATCCCTAG
AA sequence Show only first row Show all	>Lus10003493 pacid=23156263 polypeptide=Lus10003493 locus=Lus10003493.g ID=Lus10003493.BGIv1.0 annot-version=v1.0 MGASIVFHGRFIPLGIEDNAPGLGGVMDRQQLLANLILSQSNLGTFAFLSKLCLGLLLLLYP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003493 [exp]	0	1
					Lus10004843 [exp]	7.6	0.8450
AT1G29050		TBL38	TRICHOME BIREFRINGENCE-LIKE 38...		Lus10039559 [exp]	9.8	0.9019
AT2G24430	NAC	ANAC039, ANAC03...	Arabidopsis NAC domain contain...		Lus10020165 [exp]	10.7	0.8249
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10041195 [exp]	11.2	0.8868
AT4G35790		ATPLDDELTA	ARABIDOPSIS THALIANA PHOSPHOLI...		Lus10001293 [exp]	12.4	0.8611
					Lus10011203 [exp]	13.7	0.8430
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020480 [exp]	15.9	0.8989
					Lus10043397 [exp]	20.9	0.8992
					Lus10021373 [exp]	22.3	0.8780
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10018748 [exp]	23.0	0.8040

Compare expression of checked genes

Lus10003493 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.