Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15360 102 / 2e-28 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 84 / 2e-21 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 81 / 6e-20 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009480 [exp] 206 / 3e-69 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 105 / 3e-29 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 103 / 2e-28 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10043271 [exp] 100 / 3e-27 AT1G15360 160 / 2e-49 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 91 / 1e-23 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 75 / 1e-17 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002912 [exp] 71 / 4e-16 AT5G25390 187 / 6e-61 shine3, Integrase-type DNA-binding superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G028000 [exp] 105 / 1e-29 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 103 / 4e-29 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 97 / 6e-26 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 95 / 3e-25 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 91 / 1e-23 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003506 pacid=23157258 polypeptide=Lus10003506 locus=Lus10003506.g ID=Lus10003506.BGIv1.0 annot-version=v1.0 ATGAGCGGCCGCAACGCCAAGACCAACTTCCCCGCCACCGCGTATCTTCACCGAAGCACTTCTTTAACTCCGGCCACAACAACTCTGAGTGCTAAGCTAA GAAAGTCCTGCTGCAAAACCACGCCGTCTCCTTCCTTAACATGCTTGCGCCTGGACAATGAGAGCTCCCACATTGGTGTGTGGCAGAAGCGGGCCGGGTC TCATTCGAATTCGAAATGGGTCATGACGGTTGAGCTCGAGAAAACCCAGTCAGCCACCGAAAAGGGAACTCTCGTTGATGGATCGTCAGAGGCCGTGGAA GGTCGGGATGAAGAGGAGGAAATGATTGCATTGCAAATGATAGATGAACTTCTTGACAATAGAAGTTAG
AA sequence Show only first row Show all	>Lus10003506 pacid=23157258 polypeptide=Lus10003506 locus=Lus10003506.g ID=Lus10003506.BGIv1.0 annot-version=v1.0 MSGRNAKTNFPATAYLHRSTSLTPATTTLSAKLRKSCCKTTPSPSLTCLRLDNESSHIGVWQKRAGSHSNSKWVMTVELEKTQSATEKGTLVDGSSEAVE GRDEEEEMIALQMIDELLDNRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10003506 [exp]	0	1
					Lus10038131 [exp]	5.9	0.7603
AT5G16920			Fasciclin-like arabinogalactan...		Lus10013786 [exp]	6.9	0.7770
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10020877 [exp]	12.6	0.7770
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Lus10000250 [exp]	13.5	0.7756
AT4G38190		ATCSLD4	ARABIDOPSIS THALIANA CELLULOSE...		Lus10001619 [exp]	15.5	0.7366
AT3G01660			S-adenosyl-L-methionine-depend...		Lus10003648 [exp]	17.3	0.7702
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10030085 [exp]	22.6	0.7545
					Lus10028090 [exp]	22.9	0.7480
AT4G16530			Family of unknown function (DU...		Lus10000730 [exp]	25.9	0.7452
AT4G38190		ATCSLD4	ARABIDOPSIS THALIANA CELLULOSE...		Lus10022982 [exp]	26.1	0.7272

Compare expression of checked genes

Lus10003506 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.