Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G33930 82 / 3e-20 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33870 79 / 2e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33950 79 / 4e-19 Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2) AT1G33970 77 / 1e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) AT1G33960 76 / 4e-18 AIG1 AVRRPT2-INDUCED GENE 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33900 75 / 8e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33910 74 / 2e-17 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33830 71 / 1e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT4G09940 72 / 2e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G26820 72 / 2e-16 ATPP2-A3 phloem protein 2-A3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005300 [exp] 93 / 5e-24 AT1G33970 321 / 7e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10009482 [exp] 88 / 6e-23 AT1G33970 148 / 9e-43 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10005299 [exp] 90 / 7e-23 AT1G33970 339 / 5e-115 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10028023 [exp] 80 / 7e-20 AT4G09940 181 / 2e-55 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10026891 [exp] 74 / 5e-18 AT2G26820 156 / 2e-45 phloem protein 2-A3 (.1) Lus10009485 [exp] 41 / 1e-05 AT1G33970 142 / 2e-42 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10003732 [exp] 41 / 2e-05 AT1G33970 210 / 1e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G104800 [exp] 85 / 2e-21 AT1G33970 314 / 3e-106 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Potri.019G077300 [exp] 85 / 2e-21 AT1G33970 345 / 2e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF04548 [flax] [poplar] AIG1 AIG1 family
Representative CDS sequence Show only first row Show all	>Lus10003507 pacid=23157262 polypeptide=Lus10003507 locus=Lus10003507.g ID=Lus10003507.BGIv1.0 annot-version=v1.0 ATGTTTGTGTCTAGGCTGTTTGATTCTTCCATTGAACAAACCGTTCTCAGCAAAGAAATCGTCGACTGCATCAAAATGGCCAGAAATGGGATTGATGCTA TCATCCTCGTCATATCAGTGGGGAATCGCTTTACCGAAGAGGAACAATCTGCCATTTGCAGTTTGCAGTCGTTGTTCGGAGCAAAGATAATGGGCTACAT GATCGTAGTGTTCACCGGTGGAGATTGA
AA sequence Show only first row Show all	>Lus10003507 pacid=23157262 polypeptide=Lus10003507 locus=Lus10003507.g ID=Lus10003507.BGIv1.0 annot-version=v1.0 MFVSRLFDSSIEQTVLSKEIVDCIKMARNGIDAIILVISVGNRFTEEEQSAICSLQSLFGAKIMGYMIVVFTGGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G33930			P-loop containing nucleoside t...		Lus10003507 [exp]	0	1
					Lus10035046 [exp]	12.9	0.7224
AT4G11650		ATOSM34	osmotin 34 (.1)		Lus10005140 [exp]	20.2	0.6939
					Lus10040159 [exp]	22.1	0.6744
AT5G42905			Polynucleotidyl transferase, r...		Lus10034950 [exp]	31.7	0.6607
AT2G23600		ATMES2, ACL, AT...	ARABIDOPSIS THALIANA METHYL ES...		Lus10012854 [exp]	66.5	0.6149
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10013728 [exp]	68.0	0.6149
					Lus10026928 [exp]	69.5	0.6149
AT2G46150			Late embryogenesis abundant (L...		Lus10027177 [exp]	70.9	0.6149
AT4G37330		CYP81D4	"cytochrome P450, family 81, s...		Lus10024817 [exp]	72.3	0.6149
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Lus10013961 [exp]	91.2	0.5597

Compare expression of checked genes

Lus10003507 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.