Lus10003509 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22830 136 / 5e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G71490 125 / 4e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49740 62 / 2e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G04860 62 / 3e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G33990 59 / 5e-10 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G17630 57 / 2e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G18750 56 / 3e-09 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G39530 56 / 5e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02750 55 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G69350 54 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009487 370 / 3e-124 AT1G71490 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027008 301 / 3e-100 AT1G71490 335 / 7e-107 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027100 223 / 1e-73 AT1G22830 111 / 1e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10026460 62 / 6e-11 AT1G15510 1030 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019278 61 / 1e-10 AT3G49740 694 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009913 59 / 5e-10 AT3G09040 1114 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10024199 58 / 1e-09 AT3G09040 1017 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10007806 57 / 2e-09 AT3G03580 967 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10011563 56 / 3e-09 AT3G49740 340 / 1e-110 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G074700 173 / 4e-50 AT1G71490 878 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G067000 61 / 6e-11 AT1G18485 500 / 8e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G059400 58 / 8e-10 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G074500 58 / 9e-10 AT3G47530 750 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G354400 57 / 2e-09 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G083700 56 / 6e-09 AT3G22690 1050 / 0.0 unknown protein
Potri.002G155100 55 / 8e-09 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G086200 55 / 9e-09 AT4G14820 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G161800 54 / 1e-08 AT2G03380 786 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G137900 54 / 1e-08 AT3G09040 421 / 3e-131 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10003509 pacid=23157285 polypeptide=Lus10003509 locus=Lus10003509.g ID=Lus10003509.BGIv1.0 annot-version=v1.0
ATGCCGCCTTCTTCACCTCGAGTGTCACTCAAGGGCTTGTTATCTGTAGCTGAGATACAAAAGTTTATACCTAGCAAGTGGAAGCAAATTGTTGCTACTA
AGCCTGCTGATACTGTTATCGTCGAGCCTCTGGTTCGCCATACTTATGCTGTTAAGGATGGATACATCATGTTAAGCTTTTTAGTAACCTGCATTAAGGA
TCTCACAAGCCAAGGCAATTTGTGCAACGCATTCGAAACATTTTCGTTAGTGCAACGACACGCGCGAACTCATCAAGACTTGCTCGTGGATTCGATTGCG
TGTCTTTTGTTCGCTTGTGCTGATCCGAAATCATTGACTTGGCAAGGAGGAAGACAGCTCCACGGGCATATGATCTCGTTAGGATTAGAGAAAGATCGTG
TTTTGGTACCGAAGCTCGTTACTTTCTACTCGAACTTCCAGTCCTTGGTTGACATTCATGCTATTGTTGAGAATGCGAATATCATGGACCCTTTGCCTTG
GAATTTGCTCATTTCGGCGTATAATAGGAATGAGCTGTATGCAAAGGCTCTTTCTGCTTATATGGAGATGAGGAGTAAAGGAGTTAGACCTGATATTTCA
CTTATCCATCGGTTCTGA
AA sequence
>Lus10003509 pacid=23157285 polypeptide=Lus10003509 locus=Lus10003509.g ID=Lus10003509.BGIv1.0 annot-version=v1.0
MPPSSPRVSLKGLLSVAEIQKFIPSKWKQIVATKPADTVIVEPLVRHTYAVKDGYIMLSFLVTCIKDLTSQGNLCNAFETFSLVQRHARTHQDLLVDSIA
CLLFACADPKSLTWQGGRQLHGHMISLGLEKDRVLVPKLVTFYSNFQSLVDIHAIVENANIMDPLPWNLLISAYNRNELYAKALSAYMEMRSKGVRPDIS
LIHRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22830 Tetratricopeptide repeat (TPR)... Lus10003509 0 1
AT5G17680 disease resistance protein (TI... Lus10026201 19.4 0.6506
AT3G22470 Pentatricopeptide repeat (PPR)... Lus10006217 38.5 0.6371
AT5G37590 Tetratricopeptide repeat (TPR)... Lus10004036 76.0 0.6099
AT5G17680 disease resistance protein (TI... Lus10005588 218.5 0.5458
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10000551 278.9 0.5301

Lus10003509 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.