Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09990 73 / 6e-17 Protein of unknown function (DUF579) (.1) AT1G09610 71 / 5e-16 Protein of unknown function (DUF579) (.1) AT1G71690 69 / 2e-15 Protein of unknown function (DUF579) (.1) AT1G33800 66 / 5e-14 Protein of unknown function (DUF579) (.1) AT1G67330 57 / 5e-11 Protein of unknown function (DUF579) (.1) AT1G27930 53 / 1e-09 Protein of unknown function (DUF579) (.1) AT2G15440 47 / 2e-07 Protein of unknown function (DUF579) (.1) AT3G50220 46 / 4e-07 IRX15 IRREGULAR XYLEM 15, Protein of unknown function (DUF579) (.1) AT5G67210 43 / 4e-06 IRX15-L IRX15-LIKE, Protein of unknown function (DUF579) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002954 [exp] 162 / 2e-51 AT4G09990 298 / 1e-101 Protein of unknown function (DUF579) (.1) Lus10005829 [exp] 84 / 6e-21 AT4G09990 360 / 8e-126 Protein of unknown function (DUF579) (.1) Lus10005822 [exp] 84 / 9e-21 AT4G09990 360 / 6e-126 Protein of unknown function (DUF579) (.1) Lus10015780 [exp] 57 / 4e-11 AT1G67330 381 / 4e-134 Protein of unknown function (DUF579) (.1) Lus10037026 [exp] 57 / 4e-11 AT1G67330 382 / 1e-134 Protein of unknown function (DUF579) (.1) Lus10006415 [exp] 56 / 2e-10 AT1G67330 368 / 1e-128 Protein of unknown function (DUF579) (.1) Lus10011360 [exp] 54 / 5e-10 AT1G67330 350 / 1e-121 Protein of unknown function (DUF579) (.1) Lus10002345 [exp] 48 / 1e-07 AT4G24910 236 / 6e-76 Protein of unknown function (DUF579) (.1) Lus10012537 [exp] 48 / 1e-07 AT1G27930 313 / 2e-107 Protein of unknown function (DUF579) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G076300 [exp] 84 / 5e-21 AT1G09610 367 / 2e-128 Protein of unknown function (DUF579) (.1) Potri.013G102200 [exp] 79 / 5e-19 AT1G33800 362 / 3e-126 Protein of unknown function (DUF579) (.1) Potri.004G226800 [exp] 74 / 3e-17 AT1G09610 424 / 4e-151 Protein of unknown function (DUF579) (.1) Potri.003G003801 [exp] 68 / 4e-15 AT1G09610 429 / 5e-153 Protein of unknown function (DUF579) (.1) Potri.001G056300 [exp] 58 / 2e-11 AT1G67330 366 / 4e-128 Protein of unknown function (DUF579) (.1) Potri.003G172300 [exp] 56 / 1e-10 AT1G67330 369 / 1e-129 Protein of unknown function (DUF579) (.1) Potri.015G096900 [exp] 50 / 1e-08 AT4G24910 248 / 6e-81 Protein of unknown function (DUF579) (.1) Potri.005G141300 [exp] 42 / 2e-05 AT5G67210 405 / 1e-142 IRX15-LIKE, Protein of unknown function (DUF579) (.1) Potri.007G047000 [exp] 42 / 2e-05 AT5G67210 399 / 2e-140 IRX15-LIKE, Protein of unknown function (DUF579) (.1) Potri.001G302600 [exp] 40 / 5e-05 AT5G67210 305 / 2e-103 IRX15-LIKE, Protein of unknown function (DUF579) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04669 [flax] [poplar] Polysacc_synt_4 Polysaccharide biosynthesis
Representative CDS sequence Show only first row Show all	>Lus10003512 pacid=23157273 polypeptide=Lus10003512 locus=Lus10003512.g ID=Lus10003512.BGIv1.0 annot-version=v1.0 ATGTGGTCATCGCTCAACCACGGCGGCCGGACGGTCTTCCTTGAAGAAAGCCCGTCGTGGATTGACCATGTCCGGCGAACTACTCCTCCTCCGGCGAGGT TGGAAATTGACAGAGTCGATTACGACACGAAGCTCTACAAGGCTTCGAGGCTGATGCAACACGCAATGGGGGATTTGGAGTGTAAGGAATTAGGTGCGGG GGTTAGAGATTCGAAGTGCCGGCTGACGATGAAGGGGCTTCCGGGGTGGTTTATGATACGGAGTGGGATTTGA
AA sequence Show only first row Show all	>Lus10003512 pacid=23157273 polypeptide=Lus10003512 locus=Lus10003512.g ID=Lus10003512.BGIv1.0 annot-version=v1.0 MWSSLNHGGRTVFLEESPSWIDHVRRTTPPPARLEIDRVDYDTKLYKASRLMQHAMGDLECKELGAGVRDSKCRLTMKGLPGWFMIRSGI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71690			Protein of unknown function (D...		Lus10003512 [exp]	0	1
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Lus10004846 [exp]	1.4	0.9257
AT3G42770			F-box/RNI-like/FBD-like domain...		Lus10021833 [exp]	2.8	0.8862
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Lus10015354 [exp]	3.2	0.9173
AT4G27890			HSP20-like chaperones superfam...		Lus10027048 [exp]	4.0	0.8807
AT1G03390			HXXXD-type acyl-transferase fa...		Lus10033079 [exp]	4.2	0.8842
AT2G45760		BAL, BAP2	BON ASSOCIATION PROTEIN 1-LIKE...		Lus10024505 [exp]	4.6	0.8808
AT1G29380			Carbohydrate-binding X8 domain...		Lus10025379 [exp]	5.0	0.8842
					Lus10018552 [exp]	5.2	0.9012
AT3G55390			Uncharacterised protein family...		Lus10001709 [exp]	5.5	0.8633
					Lus10011661 [exp]	6.0	0.8742

Compare expression of checked genes

Lus10003512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.