Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07040 78 / 1e-17 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) AT1G59620 54 / 2e-09 CW9 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G58602 50 / 4e-08 LRR and NB-ARC domains-containing disease resistance protein (.1.2) AT5G35450 48 / 3e-07 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G58410 47 / 5e-07 Disease resistance protein (CC-NBS-LRR class) family (.1) AT3G46530 46 / 1e-06 RPP13 RECOGNITION OF PERONOSPORA PARASITICA 13, NB-ARC domain-containing disease resistance protein (.1) AT1G53350 45 / 2e-06 Disease resistance protein (CC-NBS-LRR class) family (.1) AT3G46710 45 / 4e-06 NB-ARC domain-containing disease resistance protein (.1) AT5G48620 44 / 8e-06 Disease resistance protein (CC-NBS-LRR class) family (.1) AT3G46730 43 / 2e-05 NB-ARC domain-containing disease resistance protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002945 [exp] 254 / 9e-81 AT3G07040 580 / 0.0 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10020016 [exp] 236 / 8e-74 AT3G07040 563 / 0.0 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10018937 [exp] 191 / 1e-57 AT3G07040 587 / 0.0 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10028639 [exp] 181 / 9e-54 AT3G07040 579 / 0.0 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10041243 [exp] 147 / 4e-42 AT3G07040 526 / 1e-172 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10019530 [exp] 125 / 2e-34 AT3G07040 311 / 4e-95 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10014922 [exp] 81 / 1e-18 AT3G07040 523 / 1e-171 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10014712 [exp] 74 / 2e-16 AT3G07040 492 / 3e-159 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10038983 [exp] 56 / 5e-10 AT3G07040 468 / 5e-150 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G216800 [exp] 87 / 5e-21 AT3G07040 573 / 0.0 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Potri.011G031312 [exp] 54 / 2e-10 AT1G58602 53 / 5e-09 LRR and NB-ARC domains-containing disease resistance protein (.1.2) Potri.005G009900 [exp] 56 / 5e-10 AT3G07040 285 / 1e-86 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Potri.005G008732 [exp] 54 / 5e-10 AT1G50180 66 / 1e-13 NB-ARC domain-containing disease resistance protein (.1) Potri.003G150200 [exp] 54 / 3e-09 AT5G43470 420 / 2e-132 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) Potri.005G035400 [exp] 53 / 5e-09 AT3G07040 422 / 6e-133 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Potri.018G013500 [exp] 53 / 6e-09 AT3G07040 484 / 7e-157 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Potri.005G035700 [exp] 50 / 8e-08 AT3G07040 397 / 1e-123 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Potri.011G165700 [exp] 50 / 8e-08 AT3G07040 471 / 1e-151 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Potri.003G149800 [exp] 49 / 2e-07 AT5G43470 421 / 4e-133 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003522 pacid=23157276 polypeptide=Lus10003522 locus=Lus10003522.g ID=Lus10003522.BGIv1.0 annot-version=v1.0 ATGGCAGCGATACCCATAGACTTCCTGGCTCAGAAGATGGAGGCATTTCTGGTAAAGGAAGCAACTTTATACGGAGAAGCTCGAGACCAAGTGGAAGAAA TGAAGCAAGAACTGATGAGCATGAGGGCATTCTTGGAGGATGCTGAAGACATCAACTCAAATGCAACCAACTCCAAATCAAAGCAAACCCAAGTTTCCCA AGTGAGAGATCTAGTCTACGATGTCGAGGACATCATCGACCGGTTTATCTACCACATTAACAAATGGCGAGGACGACGTACATTCGTATGGTACGTTAAG CGAACCGTTGGCTTCCCCAAGTACTTCTGGGAAAGACGACAGATTGCCACCGGACTCCGACAGCTCAATGGCTGA
AA sequence Show only first row Show all	>Lus10003522 pacid=23157276 polypeptide=Lus10003522 locus=Lus10003522.g ID=Lus10003522.BGIv1.0 annot-version=v1.0 MAAIPIDFLAQKMEAFLVKEATLYGEARDQVEEMKQELMSMRAFLEDAEDINSNATNSKSKQTQVSQVRDLVYDVEDIIDRFIYHINKWRGRRTFVWYVK RTVGFPKYFWERRQIATGLRQLNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10003522 [exp]	0	1
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10003521 [exp]	1.0	0.9029
AT5G03040		IQD2	IQ-domain 2 (.1.2.3)		Lus10015068 [exp]	15.0	0.8228
AT5G48830			unknown protein		Lus10038165 [exp]	17.8	0.8764
AT5G52970			thylakoid lumen 15.0 kDa prote...		Lus10001399 [exp]	21.6	0.8169
AT5G52100		CRR1	chlororespiration reduction 1,...		Lus10005771 [exp]	30.0	0.8015
AT5G10620			methyltransferases (.1)		Lus10020175 [exp]	30.9	0.8230
AT4G09010		TL29, APX4	thylakoid lumen 29, ascorbate ...		Lus10020942 [exp]	32.7	0.8315
AT2G39190		ATATH8	Protein kinase superfamily pro...		Lus10036522 [exp]	33.5	0.8110
AT2G04940			scramblase-related (.1)		Lus10004532 [exp]	39.0	0.7895
AT1G53140		DRP5A	Dynamin related protein 5A (.1...		Lus10008749 [exp]	41.7	0.7781

Compare expression of checked genes

Lus10003522 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.