Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03950 97 / 1e-26 VPS2.3 vacuolar protein sorting-associated protein 2.3 (.1) AT5G44560 86 / 3e-22 VPS2.2 SNF7 family protein (.1.2) AT2G06530 50 / 2e-08 VPS2.1 SNF7 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033914 [exp] 107 / 2e-30 AT1G03950 278 / 5e-96 vacuolar protein sorting-associated protein 2.3 (.1) Lus10038407 [exp] 89 / 2e-23 AT5G44560 323 / 5e-113 SNF7 family protein (.1.2) Lus10023396 [exp] 87 / 2e-22 AT5G44560 270 / 2e-91 SNF7 family protein (.1.2) Lus10021561 [exp] 52 / 8e-10 AT2G06530 194 / 1e-63 SNF7 family protein (.1) Lus10037660 [exp] 52 / 2e-09 AT2G06530 358 / 6e-127 SNF7 family protein (.1) Lus10017166 [exp] 52 / 2e-09 AT2G06530 357 / 2e-126 SNF7 family protein (.1) Lus10015642 [exp] 46 / 3e-07 AT2G06530 338 / 1e-118 SNF7 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G227000 [exp] 94 / 2e-25 AT1G03950 309 / 3e-108 vacuolar protein sorting-associated protein 2.3 (.1) Potri.011G154700 [exp] 92 / 8e-25 AT5G44560 331 / 1e-116 SNF7 family protein (.1.2) Potri.002G035900 [exp] 92 / 2e-24 AT1G03950 308 / 8e-108 vacuolar protein sorting-associated protein 2.3 (.1) Potri.001G442500 [exp] 87 / 6e-23 AT5G44560 328 / 3e-115 SNF7 family protein (.1.2) Potri.018G065100 [exp] 54 / 3e-10 AT2G06530 332 / 9e-117 SNF7 family protein (.1) Potri.001G170400 [exp] 52 / 3e-09 AT2G06530 326 / 2e-114 SNF7 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0235 [flax] [poplar] PspA PF03357 [flax] [poplar] Snf7 Snf7
Representative CDS sequence Show only first row Show all	>Lus10003538 pacid=23155651 polypeptide=Lus10003538 locus=Lus10003538.g ID=Lus10003538.BGIv1.0 annot-version=v1.0 ATGGCGACTATGAATAAGCAAATGGATCCTGCAAAGCAAGCAAAGGTTATGAGGGAATTTCAGAAACAGTCAGCACAGATGGATATGACTACTAAGATGA TGTCAGAAACCATAGACGAGGTATTGGACGATGATGAGGCTGAAGAGGAGACTGATGACTTGACAAATCAGGTGTTGGACGAAATCGGCGTTGATGTAGC CTCACAGGTCAGTATCTGCTGTAAATGGACTTGGTTTAGCAACTTCAGTTGTTGGGATTCTGCTTAA
AA sequence Show only first row Show all	>Lus10003538 pacid=23155651 polypeptide=Lus10003538 locus=Lus10003538.g ID=Lus10003538.BGIv1.0 annot-version=v1.0 MATMNKQMDPAKQAKVMREFQKQSAQMDMTTKMMSETIDEVLDDDEAEEETDDLTNQVLDEIGVDVASQVSICCKWTWFSNFSCWDSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G03950		VPS2.3	vacuolar protein sorting-assoc...		Lus10003538 [exp]	0	1

Compare expression of checked genes

Lus10003538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.