Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033892 [exp] 121 / 8e-38 ND / Lus10033891 [exp] 61 / 7e-14 ND / Lus10024888 [exp] 58 / 4e-11 AT2G36070 445 / 8e-154 translocase inner membrane subunit 44-2 (.1) Lus10039763 [exp] 50 / 3e-09 ND / Lus10039764 [exp] 48 / 1e-08 ND / Lus10039765 [exp] 48 / 1e-08 ND / Lus10018538 [exp] 47 / 4e-08 AT2G35635 51 / 6e-09 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1) Lus10039759 [exp] 43 / 1e-06 ND / Lus10018536 [exp] 43 / 1e-06 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G224300 [exp] 76 / 1e-19 ND / Potri.007G106900 [exp] 68 / 3e-16 ND / Potri.005G061780 [exp] 64 / 1e-14 ND / Potri.007G117900 [exp] 63 / 2e-14 ND / Potri.002G038350 [exp] 62 / 2e-14 ND / Potri.007G109600 [exp] 61 / 1e-13 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0187 [flax] [poplar] LysM PF01476 [flax] [poplar] LysM LysM domain
Representative CDS sequence Show only first row Show all	>Lus10003555 pacid=23155660 polypeptide=Lus10003555 locus=Lus10003555.g ID=Lus10003555.BGIv1.0 annot-version=v1.0 ATGGCAACCGTCAGCACCAAAACCATCATTATGTTTCTTCTTATCTCCACTCTGGTTCTCAGTACCACTGCAATGATGAGTGGCGGGCGAAGGTTGGCTC AGGCTACGCCTAAACTGGAGTGCAGCACAGTTTATGGAACACAAGGTGGAGACACATGCACATCGGTGGCAGGGCAGTTTGGGCTGAAACTGAAGGATTT TTTGACAATCAATCCTAACATCAACTGCGCTACTATCTTTGTTGGCCAATGGCTCTGCACTGCCCTTGCTTAA
AA sequence Show only first row Show all	>Lus10003555 pacid=23155660 polypeptide=Lus10003555 locus=Lus10003555.g ID=Lus10003555.BGIv1.0 annot-version=v1.0 MATVSTKTIIMFLLISTLVLSTTAMMSGGRRLAQATPKLECSTVYGTQGGDTCTSVAGQFGLKLKDFLTINPNINCATIFVGQWLCTALA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003555 [exp]	0	1
					Lus10029509 [exp]	1.7	0.7204
AT2G07180			Protein kinase superfamily pro...		Lus10008546 [exp]	5.5	0.6101
AT3G28857	bHLH	PRE5	Paclobutrazol Resistance 5, ba...		Lus10008626 [exp]	22.2	0.6295
AT5G13490		AAC2	ADP/ATP carrier 2 (.1.2)		Lus10031276 [exp]	22.4	0.6954
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10002190 [exp]	30.2	0.4836
AT2G36640		ATECP63	embryonic cell protein 63 (.1)		Lus10008638 [exp]	36.3	0.5044
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10032020 [exp]	47.2	0.5796
AT4G37770		ACS8	1-amino-cyclopropane-1-carboxy...		Lus10007223 [exp]	49.7	0.5674
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10017302 [exp]	51.8	0.5048
					Lus10027052 [exp]	53.2	0.5074

Compare expression of checked genes

Lus10003555 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.