Lus10003565 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45380 166 / 2e-48 ATDUR3 DEGRADATION OF UREA 3, solute:sodium symporters;urea transmembrane transporters (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033882 224 / 1e-70 AT5G45380 790 / 0.0 DEGRADATION OF UREA 3, solute:sodium symporters;urea transmembrane transporters (.1)
Lus10037255 196 / 1e-59 AT5G45380 1095 / 0.0 DEGRADATION OF UREA 3, solute:sodium symporters;urea transmembrane transporters (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G104000 175 / 5e-52 AT5G45380 1028 / 0.0 DEGRADATION OF UREA 3, solute:sodium symporters;urea transmembrane transporters (.1)
PFAM info
Representative CDS sequence
>Lus10003565 pacid=23155661 polypeptide=Lus10003565 locus=Lus10003565.g ID=Lus10003565.BGIv1.0 annot-version=v1.0
ATGGATGGGATACAACAAGGAAGATCACAACCGTCGAGAAGGAGATTAATAGTGAAACTTCCGGCTGAAGAGTTCAAAGAGGAGAAGCTCAAGAGGGCCA
AAGCCTGGATTGTCAAATGGGGAATTGCTTTCACTCTTGTTATCGTTGTATTGTGGCCACTTCTCAGCCTTCCAGCTAGGGAGTTCAACTTGGGATACTT
CACTTTCCGGGCTGCGATTTCCATAGCATGGGGCACCATTGGATCGGCAGTGATTATCGCTCTCACTTTGATCGAAATTCAGGATACCATCAAAAATTTG
TTCCTTGGGATGTTTACAAATGACAGGCTAATGAAGAAACTTGAAGAAATTGACACAAAGCTGGAAACTATCATACTGAGTATTCCTGAAGCCGAAATTT
CATACCTGCTTCAGAAGGATAATAAAGCTAAGAAGAGACGTGAGTCTCCATCTGAAGCTTAG
AA sequence
>Lus10003565 pacid=23155661 polypeptide=Lus10003565 locus=Lus10003565.g ID=Lus10003565.BGIv1.0 annot-version=v1.0
MDGIQQGRSQPSRRRLIVKLPAEEFKEEKLKRAKAWIVKWGIAFTLVIVVLWPLLSLPAREFNLGYFTFRAAISIAWGTIGSAVIIALTLIEIQDTIKNL
FLGMFTNDRLMKKLEEIDTKLETIILSIPEAEISYLLQKDNKAKKRRESPSEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45380 ATDUR3 DEGRADATION OF UREA 3, solute:... Lus10003565 0 1
AT5G45380 ATDUR3 DEGRADATION OF UREA 3, solute:... Lus10000112 2.0 0.7990
AT4G08910 unknown protein Lus10025524 2.6 0.8206
AT5G59845 Gibberellin-regulated family p... Lus10001407 13.0 0.7176
AT4G30610 SCPL24, BRS1 SERINE CARBOXYPEPTIDASE 24 PRE... Lus10019954 18.0 0.8120
AT5G01870 Bifunctional inhibitor/lipid-t... Lus10025148 18.2 0.8132
AT5G28300 Trihelix Duplicated homeodomain-like su... Lus10015924 18.7 0.7448
AT1G11820 O-Glycosyl hydrolases family 1... Lus10031456 20.1 0.7943
AT2G22560 Kinase interacting (KIP1-like)... Lus10025717 26.1 0.7697
AT3G58100 PDCB5 plasmodesmata callose-binding ... Lus10002193 26.1 0.7599
AT2G35760 Uncharacterised protein family... Lus10039060 29.7 0.7281

Lus10003565 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.