Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31280 119 / 4e-32 bHLH bHLH155 ,CPuORF7 conserved peptide upstream open reading frame 7 (.1.2.3.4) AT1G06150 115 / 4e-31 bHLH bHLH089, EMB1444 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) AT1G64625 57 / 2e-10 bHLH bHLH157 Serine/threonine-protein kinase WNK (With No Lysine)-related (.1), Serine/threonine-protein kinase WNK (With No Lysine)-related (.2), Serine/threonine-protein kinase WNK (With No Lysine)-related (.3) AT2G27230 56 / 4e-10 bHLH LHW, bHLH156 LONESOME HIGHWAY, transcription factor-related (.1.2) AT5G53900 54 / 2e-09 Serine/threonine-protein kinase WNK (With No Lysine)-related (.1), Serine/threonine-protein kinase WNK (With No Lysine)-related (.2) AT3G15240 51 / 2e-08 Serine/threonine-protein kinase WNK (With No Lysine)-related (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000609 [exp] 242 / 2e-77 AT2G31280 483 / 2e-161 conserved peptide upstream open reading frame 7 (.1.2.3.4) Lus10033880 [exp] 235 / 1e-74 AT2G31280 481 / 7e-160 conserved peptide upstream open reading frame 7 (.1.2.3.4) Lus10001527 [exp] 59 / 6e-11 AT1G64625 216 / 5e-62 Serine/threonine-protein kinase WNK (With No Lysine)-related (.1), Serine/threonine-protein kinase WNK (With No Lysine)-related (.2), Serine/threonine-protein kinase WNK (With No Lysine)-related (.3) Lus10033222 [exp] 58 / 1e-10 AT1G64625 211 / 2e-60 Serine/threonine-protein kinase WNK (With No Lysine)-related (.1), Serine/threonine-protein kinase WNK (With No Lysine)-related (.2), Serine/threonine-protein kinase WNK (With No Lysine)-related (.3) Lus10013348 [exp] 57 / 1e-10 AT2G27230 355 / 6e-112 LONESOME HIGHWAY, transcription factor-related (.1.2) Lus10041936 [exp] 47 / 9e-07 AT5G53900 419 / 7e-146 Serine/threonine-protein kinase WNK (With No Lysine)-related (.1), Serine/threonine-protein kinase WNK (With No Lysine)-related (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G222500 [exp] 171 / 5e-51 AT2G31280 568 / 0.0 conserved peptide upstream open reading frame 7 (.1.2.3.4) Potri.002G040600 [exp] 155 / 4e-45 AT2G31280 437 / 7e-144 conserved peptide upstream open reading frame 7 (.1.2.3.4) Potri.006G090000 [exp] 77 / 1e-17 AT1G06150 195 / 6e-53 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Potri.003G144900 [exp] 68 / 3e-14 AT2G27230 233 / 2e-66 LONESOME HIGHWAY, transcription factor-related (.1.2) Potri.001G086000 [exp] 66 / 1e-13 AT2G27230 248 / 7e-72 LONESOME HIGHWAY, transcription factor-related (.1.2) Potri.001G397800 [exp] 51 / 2e-08 AT5G53900 439 / 1e-153 Serine/threonine-protein kinase WNK (With No Lysine)-related (.1), Serine/threonine-protein kinase WNK (With No Lysine)-related (.2) Potri.001G216900 [exp] 50 / 4e-08 AT2G27230 363 / 3e-113 LONESOME HIGHWAY, transcription factor-related (.1.2) Potri.011G116400 [exp] 50 / 6e-08 AT5G53900 438 / 3e-153 Serine/threonine-protein kinase WNK (With No Lysine)-related (.1), Serine/threonine-protein kinase WNK (With No Lysine)-related (.2) Potri.009G017700 [exp] 49 / 1e-07 AT2G27230 355 / 2e-110 LONESOME HIGHWAY, transcription factor-related (.1.2) Potri.014G024000 [exp] 41 / 7e-05 AT1G60060 243 / 4e-77 Serine/threonine-protein kinase WNK (With No Lysine)-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003569 pacid=23155671 polypeptide=Lus10003569 locus=Lus10003569.g ID=Lus10003569.BGIv1.0 annot-version=v1.0 ATGGGGACTGCCTTGCATCAGACGCTTAAGAGCCTCTGCTTTAACACTGAGTGGAAATATGCAGTTTTGTGGAAGCTCAAACATTGTTCGCGCATGGTGT TAACATGCGAAGATTCCTACTACGATAATTTCCAGCAATGTGATCCTCTGGAGAACGAATGCTCCAGTGAGAAGCCTGAAAACTTGCGTGGCATTTGCAA TCCGTGTGACCTCCTTGGATTAGCGGTTGCAAAGATGTCATACCACGTATTCTCATTGGGAGAAGGGATTGTTGGACAGGTAGCTGTTTGTGGGAAGTAT CAATGGATTTTTGCTGACAACCATGCATCCAATTCTTCATCATTTGAGGTGACGCTAATGTTTCAGTAG
AA sequence Show only first row Show all	>Lus10003569 pacid=23155671 polypeptide=Lus10003569 locus=Lus10003569.g ID=Lus10003569.BGIv1.0 annot-version=v1.0 MGTALHQTLKSLCFNTEWKYAVLWKLKHCSRMVLTCEDSYYDNFQQCDPLENECSSEKPENLRGICNPCDLLGLAVAKMSYHVFSLGEGIVGQVAVCGKY QWIFADNHASNSSSFEVTLMFQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Lus10003569 [exp]	0	1
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Lus10000609 [exp]	5.7	0.7946
AT5G09730		ATBXL3, XYL3, B...	beta-xylosidase 3 (.1)		Lus10025036 [exp]	6.3	0.8307
AT5G60690	HD	IFL1, REV	REVOLUTA, INTERFASCICULAR FIBE...		Lus10021470 [exp]	23.4	0.7939
AT5G24760			GroES-like zinc-binding dehydr...		Lus10031319 [exp]	24.2	0.8062
AT1G24764		ATMAP70-2	microtubule-associated protein...		Lus10039069 [exp]	24.4	0.8150
AT3G23590		MED33A, RFR1	REF4-related 1 (.1)		Lus10004434 [exp]	26.3	0.7680
AT2G33385		ARPC2B	actin-related protein C2B (.1....		Lus10023737 [exp]	26.5	0.8143
AT1G08930		ERD6	EARLY RESPONSE TO DEHYDRATION ...		Lus10033812 [exp]	30.0	0.7486
AT5G65760			Serine carboxypeptidase S28 fa...		Lus10039645 [exp]	30.9	0.7709
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Lus10026299 [exp]	32.2	0.8121

Compare expression of checked genes

Lus10003569 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.