Lus10003582 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57230 264 / 5e-92 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G143500 262 / 4e-91 AT5G57230 274 / 7e-96 Thioredoxin superfamily protein (.1)
Potri.006G076300 258 / 2e-89 AT5G57230 263 / 1e-91 Thioredoxin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10003582 pacid=23165474 polypeptide=Lus10003582 locus=Lus10003582.g ID=Lus10003582.BGIv1.0 annot-version=v1.0
ATGGACCAGCAGTCATTTTTCGACCGAATGCTCAGTCAGCTACGCTGCACATGCAAGTATTACACTGGACATCCAAAAGATCTTGGCCCGTCACGAGTTA
TACATTTTACATCGGAACGCGAGTTTGTCAAGCTTCTGCATGAAGGTTACCCGGTGGCAGTCGCGTTTACCATCAGGAGTAATTACACTAAACATCTTGA
CAAAGTGCTCGAGGAAGCTGCAGCTGAGTTTTCCCCTGGTGTCAAATTTATGAGGGTTGAATGTCCGAAATATCCAGGATTTTGTATAACACGGCAGAAA
AAGGAGTATCCATTCATTGAAATCTTCCACAGTCCAGAACAAGCAGCTAACGAGGGAAAGGCTATCGACCCCGGTACCACCAGATACGCTGTTAAAGTTC
TACCTTTCCACTACGATGTCAGTCCCTATGGATTCAGAGAGTTCTTCAAGCGCTACGGAATAGGACCGTTAAATCAAAAGGGAACGTCAGAATAA
AA sequence
>Lus10003582 pacid=23165474 polypeptide=Lus10003582 locus=Lus10003582.g ID=Lus10003582.BGIv1.0 annot-version=v1.0
MDQQSFFDRMLSQLRCTCKYYTGHPKDLGPSRVIHFTSEREFVKLLHEGYPVAVAFTIRSNYTKHLDKVLEEAAAEFSPGVKFMRVECPKYPGFCITRQK
KEYPFIEIFHSPEQAANEGKAIDPGTTRYAVKVLPFHYDVSPYGFREFFKRYGIGPLNQKGTSE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G57230 Thioredoxin superfamily protei... Lus10003582 0 1
AT1G68310 AE7 AS1/2 ENHANCER7, Protein of un... Lus10031006 1.4 0.9373
AT3G54170 ATFIP37 FKBP12 interacting protein 37 ... Lus10027681 1.7 0.9236
AT1G15910 FDM1 factor of DNA methylation 1, X... Lus10036870 3.9 0.9120
AT2G26990 COP12, ATCSN2, ... FUSCA 12, CONSTITUTIVE PHOTOMO... Lus10041295 4.0 0.9273
AT4G38980 unknown protein Lus10035474 4.0 0.9086
AT3G59990 MAP2B methionine aminopeptidase 2B (... Lus10010592 5.7 0.8966
Lus10015592 7.7 0.8967
AT4G33100 unknown protein Lus10033863 10.8 0.8742
AT2G05630 ATG8D Ubiquitin-like superfamily pro... Lus10039656 12.6 0.8931
AT3G63030 MBD4 methyl-CPG-binding domain 4 (.... Lus10042674 13.7 0.9094

Lus10003582 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.