Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43580 40 / 4e-05 Chitinase family protein (.1) AT2G43610 40 / 5e-05 Chitinase family protein (.1) AT3G54420 39 / 9e-05 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) AT2G43570 37 / 0.0003 CHI "chitinase, putative", chitinase, putative (.1) AT2G43590 37 / 0.0004 Chitinase family protein (.1) AT3G12500 37 / 0.0004 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1) AT2G43620 37 / 0.0006 Chitinase family protein (.1) AT3G04720 36 / 0.0009 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003586 [exp] 54 / 6e-11 AT2G43610 43 / 4e-06 Chitinase family protein (.1) Lus10003585 [exp] 48 / 9e-09 AT3G12500 47 / 1e-07 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10006552 [exp] 41 / 1e-05 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10028377 [exp] 38 / 0.0003 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10041830 [exp] 38 / 0.0004 AT3G12500 402 / 4e-141 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G041700 [exp] 42 / 5e-06 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041600 [exp] 41 / 1e-05 AT3G04720 266 / 3e-91 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041900 [exp] 41 / 1e-05 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.005G054000 [exp] 39 / 0.0001 AT3G04720 238 / 9e-81 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.009G141700 [exp] 38 / 0.0003 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.004G182000 [exp] 37 / 0.0005 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.013G125000 [exp] 37 / 0.0006 AT3G54420 421 / 1e-150 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.009G142300 [exp] 36 / 0.001 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00187 [flax] [poplar] Chitin_bind_1 Chitin recognition protein
Representative CDS sequence Show only first row Show all	>Lus10003584 pacid=23165469 polypeptide=Lus10003584 locus=Lus10003584.g ID=Lus10003584.BGIv1.0 annot-version=v1.0 ATGGAGAAGAAGCTCGCCATCAATGTGGTCCTCGTCCTCCTTATTCTATCAATAGTGACGAATTTGGAAGTTGCCGCTATATCTCACCCTTGTGGCCAGC GAGCCCATGGGAAGCTTTGTCGTCGTCATGGCAACGACAAGGTCGCTTGCTGCAGTAAGCTGGGATACTGTGGATCGACAGAGGACTACTGCAGCATTGA AAAAGGATGTCAAAGCGGTGACTGTCGTGATTACCCAAGTACAAAGTGA
AA sequence Show only first row Show all	>Lus10003584 pacid=23165469 polypeptide=Lus10003584 locus=Lus10003584.g ID=Lus10003584.BGIv1.0 annot-version=v1.0 MEKKLAINVVLVLLILSIVTNLEVAAISHPCGQRAHGKLCRRHGNDKVACCSKLGYCGSTEDYCSIEKGCQSGDCRDYPSTK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43610			Chitinase family protein (.1)		Lus10003584 [exp]	0	1
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10037796 [exp]	10.3	0.6660
AT3G05610			Plant invertase/pectin methyle...		Lus10031469 [exp]	12.2	0.7604
AT1G21850		SKS8	SKU5 similar 8 (.1)		Lus10022648 [exp]	18.3	0.7495
AT5G22450			unknown protein		Lus10000530 [exp]	21.5	0.7494
					Lus10011078 [exp]	24.8	0.7494
					Lus10011832 [exp]	27.7	0.7494
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015750 [exp]	30.4	0.7494
					Lus10003536 [exp]	32.8	0.7494
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	35.1	0.7494
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Lus10032879 [exp]	37.2	0.7494

Compare expression of checked genes

Lus10003584 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.