Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12500 40 / 5e-05 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003584 [exp] 47 / 1e-08 AT2G43610 44 / 2e-06 Chitinase family protein (.1) Lus10028377 [exp] 42 / 1e-05 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10041830 [exp] 41 / 2e-05 AT3G12500 402 / 4e-141 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10006552 [exp] 40 / 3e-05 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10020338 [exp] 37 / 0.0002 AT2G43620 57 / 2e-10 Chitinase family protein (.1) Lus10003586 [exp] 36 / 0.0006 AT2G43610 43 / 4e-06 Chitinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G041600 [exp] 41 / 1e-05 AT3G04720 266 / 3e-91 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.004G182000 [exp] 40 / 3e-05 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.013G041900 [exp] 40 / 3e-05 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.009G142000 [exp] 40 / 4e-05 AT3G12500 346 / 6e-119 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G141700 [exp] 40 / 6e-05 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.005G054000 [exp] 39 / 6e-05 AT3G04720 238 / 9e-81 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041700 [exp] 39 / 0.0001 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.009G142300 [exp] 39 / 0.0002 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00187 [flax] [poplar] Chitin_bind_1 Chitin recognition protein
Representative CDS sequence Show only first row Show all	>Lus10003585 pacid=23165483 polypeptide=Lus10003585 locus=Lus10003585.g ID=Lus10003585.BGIv1.0 annot-version=v1.0 ATGGAGAACAAGAAGCTCGTAATCAATACGATTCTCGTCCTCATTCTCATTGCAACGGCGGTAACGAATACTTTAACTGTCGCAAATGCTCAGATCTGCG GCCACCAAGCCGGCGGGAATCCTTGCCCTGGAGGTGACGCAGTGGGCCTTTGCTGCAGTAAGAAGGGATTCTGTGGATGTACAGACGAATACTGTATGAA AGATGCAGGATGTCAAAGCGGGTTGTGCCGCGACGGGCCGGGTTATTGA
AA sequence Show only first row Show all	>Lus10003585 pacid=23165483 polypeptide=Lus10003585 locus=Lus10003585.g ID=Lus10003585.BGIv1.0 annot-version=v1.0 MENKKLVINTILVLILIATAVTNTLTVANAQICGHQAGGNPCPGGDAVGLCCSKKGFCGCTDEYCMKDAGCQSGLCRDGPGY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10003585 [exp]	0	1
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10003345 [exp]	1.0	1.0000
AT3G04380		SDG31, SUVR4	SET DOMAIN PROTEIN 31, SET-dom...		Lus10005476 [exp]	2.0	0.9848
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10013268 [exp]	2.4	1.0000
AT4G21690		ATGA3OX3	ARABIDOPSIS THALIANA GIBBERELL...		Lus10013134 [exp]	2.6	0.9738
AT3G05950			RmlC-like cupins superfamily p...		Lus10035280 [exp]	3.0	1.0000
					Lus10042250 [exp]	3.6	0.8219
AT5G03050			unknown protein		Lus10030557 [exp]	3.7	0.8127
					Lus10014650 [exp]	4.5	0.9806
					Lus10027457 [exp]	4.9	0.9787
AT4G24580		REN1	ROP1 ENHANCER 1, Rho GTPase ac...		Lus10005733 [exp]	5.7	0.9572

Compare expression of checked genes

Lus10003585 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.