Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43610 44 / 3e-06 Chitinase family protein (.1) AT3G54420 37 / 0.0005 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) AT3G12500 37 / 0.0005 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003584 [exp] 70 / 3e-17 AT2G43610 44 / 2e-06 Chitinase family protein (.1) Lus10003585 [exp] 53 / 2e-10 AT3G12500 47 / 1e-07 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10006552 [exp] 49 / 4e-08 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10041830 [exp] 43 / 5e-06 AT3G12500 402 / 4e-141 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10028377 [exp] 42 / 9e-06 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10041828 [exp] 40 / 2e-05 AT3G12500 59 / 8e-12 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10020253 [exp] 40 / 8e-05 AT2G43610 54 / 4e-09 Chitinase family protein (.1) Lus10001773 [exp] 39 / 0.0001 AT2G43570 51 / 6e-08 "chitinase, putative", chitinase, putative (.1) Lus10001772 [exp] 37 / 0.0002 AT2G43610 44 / 5e-06 Chitinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G041700 [exp] 48 / 7e-08 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041600 [exp] 47 / 2e-07 AT3G04720 266 / 3e-91 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041900 [exp] 44 / 2e-06 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.005G054000 [exp] 41 / 2e-05 AT3G04720 238 / 9e-81 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.009G141700 [exp] 40 / 9e-05 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142300 [exp] 39 / 0.0001 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.004G182000 [exp] 39 / 0.0002 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.019G094000 [exp] 38 / 0.0002 AT3G54420 340 / 2e-118 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) Potri.009G142000 [exp] 37 / 0.0005 AT3G12500 346 / 6e-119 PATHOGENESIS-RELATED 3, basic chitinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00187 [flax] [poplar] Chitin_bind_1 Chitin recognition protein
Representative CDS sequence Show only first row Show all	>Lus10003586 pacid=23165468 polypeptide=Lus10003586 locus=Lus10003586.g ID=Lus10003586.BGIv1.0 annot-version=v1.0 ATGGAGAAGAAGCTGGTCATCGTCATCAATGCGGTCATGATCTTCCTCCTTGTGATATCAATAGCTACGCCGCAACCTGCGCTGGCGGCGGATGCTCCGA ACTGCGGCTCCGAATGCGGCTACCAAAACTGTCCCAAGAAACACCCTTGCTGCAGTGAGCTTGGGTACTGCGGATCGACGGAGGACTACTGTAGCCTTGA AAAAGGATGTCAAACTGCAAGCGGAAAATGTCGACATTTCCCACCGCAGCACGCGTTAAGAGTGAACCTTACAACTTGA
AA sequence Show only first row Show all	>Lus10003586 pacid=23165468 polypeptide=Lus10003586 locus=Lus10003586.g ID=Lus10003586.BGIv1.0 annot-version=v1.0 MEKKLVIVINAVMIFLLVISIATPQPALAADAPNCGSECGYQNCPKKHPCCSELGYCGSTEDYCSLEKGCQTASGKCRHFPPQHALRVNLTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43610			Chitinase family protein (.1)		Lus10003586 [exp]	0	1
					Lus10018627 [exp]	4.2	0.9026
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10028306 [exp]	4.4	0.9285
AT2G35740		ATINT3	nositol transporter 3 (.1)		Lus10017559 [exp]	6.3	0.8986
					Lus10035048 [exp]	8.1	0.9264
AT5G67470		ATFH6	ARABIDOPSIS FORMIN HOMOLOG 6, ...		Lus10002464 [exp]	8.5	0.8536
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10014406 [exp]	10.0	0.9219
					Lus10035062 [exp]	11.2	0.9261
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Lus10029233 [exp]	13.5	0.7985
AT3G14570		ATGSL4, ATGSL04	glucan synthase-like 4 (.1.2)		Lus10026188 [exp]	15.2	0.9039
					Lus10024445 [exp]	15.4	0.8849

Compare expression of checked genes

Lus10003586 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.