Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G130400 [exp] 39 / 0.0002 AT5G54585 49 / 4e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003592 pacid=23163404 polypeptide=Lus10003592 locus=Lus10003592.g ID=Lus10003592.BGIv1.0 annot-version=v1.0 ATGAGGTTCCTATTCGACTTCGTCTCCTGTTGCGGGACCTCCGACTACGAGAATCCCAACAACGCCGGGAGGAGGAAGATCCAGTCAGAGGAGGAGACCC AGGGGCTGGCTTCACAACCCACGAACGTCGCGCGTGCCGTTGAATCCACGGAAATTACGCCCGGATCAGGACGCAGCCGGACGAGGAAGAGGAGCAGAGC TGCGGGGTCGGGGACAGGGGAAAACTGGAAGCCGTCCCTGGCAGCGATTGCAGAAGACAACGCTGCGGCGGCGGAGGAGAAACAGAAATGGAGGGAGAAA GAGAAGGCGATTAAGAGGAAGGGCAGCGTTCGGAGCCGTGGTGGATCCGGTGATTCTTCCTACTGGTAA
AA sequence Show only first row Show all	>Lus10003592 pacid=23163404 polypeptide=Lus10003592 locus=Lus10003592.g ID=Lus10003592.BGIv1.0 annot-version=v1.0 MRFLFDFVSCCGTSDYENPNNAGRRKIQSEEETQGLASQPTNVARAVESTEITPGSGRSRTRKRSRAAGSGTGENWKPSLAAIAEDNAAAAEEKQKWREK EKAIKRKGSVRSRGGSGDSSYW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003592 [exp]	0	1
AT3G04590	AT-hook		AT hook motif DNA-binding fami...		Lus10006573 [exp]	2.2	0.8232
AT3G25570			Adenosylmethionine decarboxyla...		Lus10034412 [exp]	2.4	0.8173
AT2G15890		MEE14	maternal effect embryo arrest ...		Lus10027938 [exp]	3.2	0.7982
AT1G08860		BON3	BONZAI 3, Calcium-dependent ph...		Lus10033826 [exp]	7.0	0.7877
AT2G40410			Staphylococcal nuclease homolo...		Lus10040967 [exp]	8.2	0.8032
AT3G07310			Protein of unknown function (D...		Lus10038208 [exp]	8.5	0.8145
AT3G25570			Adenosylmethionine decarboxyla...		Lus10000156 [exp]	8.8	0.7978
AT5G22920			CHY-type/CTCHY-type/RING-type ...		Lus10023914 [exp]	11.0	0.7676
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Lus10041487 [exp]	12.5	0.7343
					Lus10018551 [exp]	13.0	0.7620

Compare expression of checked genes

Lus10003592 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.