Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44005 39 / 4e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008219 [exp] 155 / 5e-49 AT5G44005 56 / 2e-10 unknown protein Lus10008220 [exp] 79 / 3e-20 AT5G44005 55 / 4e-11 unknown protein Lus10003608 [exp] 77 / 2e-19 AT5G44005 55 / 4e-11 unknown protein Lus10003610 [exp] 76 / 3e-19 AT5G44005 59 / 1e-12 unknown protein Lus10008224 [exp] 74 / 1e-18 AT5G44005 57 / 6e-12 unknown protein Lus10003609 [exp] 66 / 5e-15 AT5G44005 51 / 9e-10 unknown protein Lus10008223 [exp] 64 / 3e-14 ND 41 / 6e-06 Lus10024940 [exp] 59 / 6e-13 ND 42 / 2e-06 Lus10008222 [exp] 59 / 2e-11 AT4G12010 327 / 4e-96 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G192100 [exp] 43 / 1e-06 AT5G44005 49 / 4e-09 unknown protein Potri.002G257600 [exp] 39 / 0.0001 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003607 pacid=23159173 polypeptide=Lus10003607 locus=Lus10003607.g ID=Lus10003607.BGIv1.0 annot-version=v1.0 ATGAAGCTGCTGAATGGTCAAAGCATGAAGAAAAACCGGTTCTTGACGAGGCTGGGGAAGAAAATTGTGAGATCCGCCACCGGCCCTTCATCTTCGACGA CTTCCTCCTCTTCTGCGGCTGTAGCCATTGTTGTTGGAAGGAAGAGAAAGGTAGCGGTAATGGGTTATGTACCGAAGAAGTTGATTTACAAGTTCAAGTC ACAGTGGAAGCAAGCCGCCATTGGTTTCCAGAACAAGGGCAGAAGCCATAATGTTAAGTACAGCTACGATATACAGAGCTATTCACTCAACTTCGATGAT GGCCTCTGCCAATGA
AA sequence Show only first row Show all	>Lus10003607 pacid=23159173 polypeptide=Lus10003607 locus=Lus10003607.g ID=Lus10003607.BGIv1.0 annot-version=v1.0 MKLLNGQSMKKNRFLTRLGKKIVRSATGPSSSTTSSSSAAVAIVVGRKRKVAVMGYVPKKLIYKFKSQWKQAAIGFQNKGRSHNVKYSYDIQSYSLNFDD GLCQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003607 [exp]	0	1
AT5G44005			unknown protein		Lus10008219 [exp]	1.0	0.9359
AT4G27590			Heavy metal transport/detoxifi...		Lus10032924 [exp]	2.8	0.8276
AT5G05830			RING/FYVE/PHD zinc finger supe...		Lus10035549 [exp]	3.5	0.8234
AT3G44716			unknown protein		Lus10009406 [exp]	5.2	0.8118
AT4G22990			Major Facilitator Superfamily ...		Lus10009314 [exp]	5.2	0.8278
AT5G66440			unknown protein		Lus10023551 [exp]	5.7	0.8633
AT3G49760	bZIP	ATBZIP5	basic leucine-zipper 5 (.1)		Lus10018662 [exp]	7.4	0.8044
AT3G55370	DOF	OBP3, AtDof3. 6	OBF-binding protein 3 (.1.2.3)		Lus10040305 [exp]	8.4	0.8106
AT1G62760			Plant invertase/pectin methyle...		Lus10028910 [exp]	10.6	0.7876
AT1G70280			NHL domain-containing protein ...		Lus10032158 [exp]	13.8	0.8259

Compare expression of checked genes

Lus10003607 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.