Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44005 39 / 7e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008223 [exp] 117 / 1e-35 ND 41 / 6e-06 Lus10008220 [exp] 98 / 8e-28 AT5G44005 55 / 4e-11 unknown protein Lus10003610 [exp] 97 / 1e-27 AT5G44005 59 / 1e-12 unknown protein Lus10008224 [exp] 96 / 4e-27 AT5G44005 57 / 6e-12 unknown protein Lus10003608 [exp] 94 / 3e-26 AT5G44005 55 / 4e-11 unknown protein Lus10008222 [exp] 97 / 1e-24 AT4G12010 327 / 4e-96 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10024940 [exp] 71 / 1e-17 ND 42 / 2e-06 Lus10003607 [exp] 66 / 5e-15 ND 48 / 2e-08 Lus10008219 [exp] 66 / 4e-14 AT5G44005 56 / 2e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G257600 [exp] 43 / 2e-06 ND / Potri.014G192100 [exp] 40 / 2e-05 AT5G44005 49 / 4e-09 unknown protein Potri.004G037500 [exp] 39 / 4e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003609 pacid=23159155 polypeptide=Lus10003609 locus=Lus10003609.g ID=Lus10003609.BGIv1.0 annot-version=v1.0 ATGAAAAGAATCCAGTTCTTGAGGTCAGGGAAGAGACTTGGTAGTAGCTCCAGCTTTACCAGATCATCTTCTTCAGCTGTTGCTGCCGCAGCCATTGTTG TGGGGAGTAAAAGAAAAGGCGGTCCTTTGGGTTGGTGGAGTAGCAGGTCTTATGTGCCAAAGAAGTGGGTTTACAAGTTCAGAGCACAATTGAAGAAGGC AATTGGTTGGAAGAAGAGCAACAGTAGTACGTGTGTGAAGTATAGCTATGACATACAGAGCTATTCCCTCAACTTTGATGATGGTGCCTGCAACCATTCT TCAACAGTTCAATAG
AA sequence Show only first row Show all	>Lus10003609 pacid=23159155 polypeptide=Lus10003609 locus=Lus10003609.g ID=Lus10003609.BGIv1.0 annot-version=v1.0 MKRIQFLRSGKRLGSSSSFTRSSSSAVAAAAIVVGSKRKGGPLGWWSSRSYVPKKWVYKFRAQLKKAIGWKKSNSSTCVKYSYDIQSYSLNFDDGACNHS STVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G44005			unknown protein		Lus10003609 [exp]	0	1
AT1G77690		LAX3	like AUX1 3 (.1)		Lus10028078 [exp]	2.4	0.8661
AT1G62760			Plant invertase/pectin methyle...		Lus10004327 [exp]	2.4	0.8715
AT1G05000		AtPFA-DSP1	plant and fungi atypical dual-...		Lus10015154 [exp]	2.4	0.8589
AT2G42690			alpha/beta-Hydrolases superfam...		Lus10041967 [exp]	3.5	0.8486
AT5G44005			unknown protein		Lus10003610 [exp]	6.5	0.8385
					Lus10022013 [exp]	6.7	0.8079
AT5G44005			unknown protein		Lus10008220 [exp]	7.5	0.8343
AT5G47610			RING/U-box superfamily protein...		Lus10025563 [exp]	8.4	0.8229
AT3G12490		ATCYS6, ATCYSB	ARABIDOPSIS THALIANA PHYTOCYST...		Lus10026117 [exp]	9.2	0.7931
AT5G02440			unknown protein		Lus10024400 [exp]	12.8	0.8398

Compare expression of checked genes

Lus10003609 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.