Lus10003616 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10003616 pacid=23159174 polypeptide=Lus10003616 locus=Lus10003616.g ID=Lus10003616.BGIv1.0 annot-version=v1.0
ATGCGCACCAATCAAATGTTTGCTGCTAATGATGAAGAAGAAGAGGAAGATGGTGCTAGTAACATTAATGGGATAATTCCTCCTACTCTCCTTTCCCTCA
AGCAACAGCTTCACAAAGACAAGGATGATGCCAGCTCACTTTCACTGTTCTTCACAGCATCCTCTCTGGCCTCACCTACTCCAACACTGTTTGGAAGTCA
GGAATTCAAGGTAACCCCTCTGCCCCAGGTTCAACTCTACTGTACTTGTTATCAATCGATACTCATGCTTGGTGGTTGGTTGCTCTTCGCGGAGGTTGGC
CAATTCACCGGTCTGATACATCCAGGTTTGCTGGGAAACGTCGATTTAACTGGTTGA
AA sequence
>Lus10003616 pacid=23159174 polypeptide=Lus10003616 locus=Lus10003616.g ID=Lus10003616.BGIv1.0 annot-version=v1.0
MRTNQMFAANDEEEEEDGASNINGIIPPTLLSLKQQLHKDKDDASSLSLFFTASSLASPTPTLFGSQEFKVTPLPQVQLYCTCYQSILMLGGWLLFAEVG
QFTGLIHPGLLGNVDLTG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003616 0 1
Lus10027034 5.1 0.8675
AT1G66240 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.... Lus10034138 7.7 0.8631
Lus10029977 11.0 0.8704
AT1G21240 WAK3 wall associated kinase 3 (.1) Lus10013387 15.0 0.8613
AT5G02530 RNA-binding (RRM/RBD/RNP motif... Lus10005895 18.6 0.8507
AT4G10925 Nuclear transport factor 2 (NT... Lus10003192 19.3 0.7756
AT5G53550 ATYSL3, YSL3 YELLOW STRIPE like 3 (.1.2) Lus10008836 22.2 0.8234
AT5G63130 Octicosapeptide/Phox/Bem1p fam... Lus10017947 26.9 0.8369
Lus10000510 27.3 0.8266
AT1G70670 AtCLO4 Arabidopsis thaliana caleosin ... Lus10041446 32.8 0.8184

Lus10003616 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.