Lus10003625 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23380 91 / 3e-23 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1)
AT4G28556 91 / 5e-23 RIC7 PAK-box/P21-Rho-binding family protein (.1)
AT2G33460 90 / 1e-22 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1)
AT2G20430 86 / 6e-21 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1)
AT1G04450 82 / 1e-19 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1)
AT4G04900 70 / 2e-15 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1)
AT1G03982 64 / 4e-13 PAK-box/P21-Rho-binding family protein (.1)
AT4G21745 51 / 2e-08 PAK-box/P21-Rho-binding family protein (.1)
AT1G61795 51 / 2e-08 PAK-box/P21-Rho-binding family protein (.1)
AT5G16490 39 / 0.0004 RIC4 ROP-interactive CRIB motif-containing protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008243 253 / 4e-87 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10018362 72 / 6e-16 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10006763 69 / 5e-15 AT4G04900 81 / 2e-19 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10007648 69 / 1e-14 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10011805 68 / 5e-14 AT2G33460 97 / 2e-24 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10021168 53 / 2e-08 AT2G33460 81 / 3e-17 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10020060 51 / 5e-08 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G227500 107 / 4e-29 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1)
Potri.002G035500 100 / 3e-26 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1)
Potri.010G069500 91 / 2e-22 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1)
Potri.008G168900 82 / 2e-19 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1)
Potri.004G020650 76 / 8e-18 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.011G025300 75 / 2e-17 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.002G233400 57 / 1e-10 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.014G147000 42 / 6e-05 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.019G053300 40 / 0.0002 AT5G16490 108 / 2e-30 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.013G086600 40 / 0.0003 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10003625 pacid=23159185 polypeptide=Lus10003625 locus=Lus10003625.g ID=Lus10003625.BGIv1.0 annot-version=v1.0
ATGAAAGGTCTCTTGAAGGGCCTCCGATACATTTCTCAGATATTCGATGATGACGAAAAGGAGCCAGAAATGCAGATTGGTAACCCTACGGATGTAAAAC
ATGTTGCTCACATTGGTTGGGATGGCAACAATGAGGGTCCTCCCACTTGGATGAACGGATTCCAGGAGCAACCAGGATCACCGGGAGGAGGAAAGAAGTC
GTCGGAGCATCCAAAATCATCCAGACGGAAGTCAGCAGCGGGTAATGAATCGGACAACAAGCACAATAATAAGAAGGCTTCCCGACACACCAAAAGGGAG
AATCAGTCGTCGGAGAAAGCAAAATCGACAGGGAGGAGTAGTTGCAAGGACGAAGTTGAAGTGGGGAGCGGCCAAGTGGATGCACCAAAGAAAGTGCGGA
GGAAGAAATCAAAAGAATCGGAGGCCGTCGAAGGTTCGAAATCCAGGTCGAAAGCTGCAGCTGTAATTAGTACTCCAGTGGAAGAAGAACGAGGCCATGG
CGGGTTTACTTAA
AA sequence
>Lus10003625 pacid=23159185 polypeptide=Lus10003625 locus=Lus10003625.g ID=Lus10003625.BGIv1.0 annot-version=v1.0
MKGLLKGLRYISQIFDDDEKEPEMQIGNPTDVKHVAHIGWDGNNEGPPTWMNGFQEQPGSPGGGKKSSEHPKSSRRKSAAGNESDNKHNNKKASRHTKRE
NQSSEKAKSTGRSSCKDEVEVGSGQVDAPKKVRRKKSKESEAVEGSKSRSKAAAVISTPVEEERGHGGFT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28556 RIC7 PAK-box/P21-Rho-binding family... Lus10003625 0 1

Lus10003625 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.