Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27090 139 / 4e-44 Ribosomal protein L14 (.1) AT2G20450 136 / 4e-43 Ribosomal protein L14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008246 [exp] 156 / 5e-51 AT2G20450 228 / 8e-79 Ribosomal protein L14 (.1) Lus10011807 [exp] 153 / 1e-49 AT2G20450 221 / 9e-76 Ribosomal protein L14 (.1) Lus10021170 [exp] 153 / 1e-49 AT2G20450 218 / 1e-74 Ribosomal protein L14 (.1) Lus10024918 [exp] 152 / 3e-49 AT2G20450 224 / 3e-77 Ribosomal protein L14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G227300 [exp] 148 / 9e-48 AT4G27090 235 / 3e-81 Ribosomal protein L14 (.1) Potri.002G035700 [exp] 148 / 9e-48 AT4G27090 234 / 8e-81 Ribosomal protein L14 (.1) Potri.008G168600 [exp] 145 / 1e-46 AT4G27090 230 / 2e-79 Ribosomal protein L14 (.1) Potri.010G069900 [exp] 139 / 2e-44 AT4G27090 228 / 2e-78 Ribosomal protein L14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0107 [flax] [poplar] KOW PF01929 [flax] [poplar] Ribosomal_L14e Ribosomal protein L14
Representative CDS sequence Show only first row Show all	>Lus10003627 pacid=23159171 polypeptide=Lus10003627 locus=Lus10003627.g ID=Lus10003627.BGIv1.0 annot-version=v1.0 ATGGGTTTCAAGAGGTACGTGGAGATCGGTAGAGTGGCGCTCATCAACTACGGCAAGGACTACGGAAAGCTCGTTGTCATCGTCGATGTCGTTGATCAGA ACAGGGCTCTGGTTGATGCACCAGATATGGTGAGGAGCCAGCTAAACTTCAAGAGGCTAACACTCACCGATATCAAGATCGAGATCAACAGGGTTCCGAA GAAGAAGACGTTGATCGAAGCAATGGAGAAAGCAGGTTTGTTTGTCCCTTGA
AA sequence Show only first row Show all	>Lus10003627 pacid=23159171 polypeptide=Lus10003627 locus=Lus10003627.g ID=Lus10003627.BGIv1.0 annot-version=v1.0 MGFKRYVEIGRVALINYGKDYGKLVVIVDVVDQNRALVDAPDMVRSQLNFKRLTLTDIKIEINRVPKKKTLIEAMEKAGLFVP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27090			Ribosomal protein L14 (.1)		Lus10003627 [exp]	0	1
AT2G04865			Aminotransferase-like, plant m...		Lus10012346 [exp]	2.2	0.7699
AT1G12650			unknown protein		Lus10024493 [exp]	2.8	0.8364
AT1G12650			unknown protein		Lus10017837 [exp]	3.6	0.8406
AT5G02610			Ribosomal L29 family protein ...		Lus10019180 [exp]	3.9	0.8161
AT3G61415		ASK21	SKP1-like 21 (.1.2)		Lus10014770 [exp]	8.4	0.7493
AT2G06010		ORG4	OBP3-responsive gene 4 (.1)		Lus10029795 [exp]	12.2	0.7461
AT3G10530			Transducin/WD40 repeat-like su...		Lus10037324 [exp]	12.8	0.7958
AT2G04480			unknown protein		Lus10001750 [exp]	14.3	0.7523
AT1G55900		TIM50, EMB1860	embryo defective 1860, Haloaci...		Lus10016610 [exp]	14.7	0.7479
AT5G13710		CPH, SMT1	CEPHALOPOD, sterol methyltrans...		Lus10029498 [exp]	16.3	0.7220

Compare expression of checked genes

Lus10003627 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.