Lus10003635 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 433 / 3e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT5G10960 395 / 4e-140 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 341 / 9e-119 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT3G44260 281 / 3e-95 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 276 / 3e-93 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 165 / 1e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 136 / 1e-38 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 125 / 7e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 123 / 3e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036291 552 / 0 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017123 427 / 7e-153 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10018330 426 / 2e-152 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10034180 289 / 3e-98 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10021304 273 / 1e-91 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10004212 270 / 2e-90 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10016980 268 / 1e-88 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 150 / 2e-43 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 148 / 1e-42 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G046700 458 / 5e-165 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 452 / 7e-163 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.018G020900 442 / 7e-159 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 442 / 1e-158 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 437 / 9e-157 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 299 / 4e-102 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 296 / 5e-101 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 282 / 4e-95 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 280 / 3e-94 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 229 / 5e-75 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10003635 pacid=23141611 polypeptide=Lus10003635 locus=Lus10003635.g ID=Lus10003635.BGIv1.0 annot-version=v1.0
ATGTCGATTCTGCCTAAGAGCGAGTCAATAATTATTCGTGACGTGTGGAATGAGAATCTAGAAGATGAATTCAATTTGATTATGGACATAGTTGATGATT
TCCCTTTCATTGCAATGGACACAGAGTTCCCTGGAATTATCGTTCGCCCCGTAGGAAATTTCAAGAACGGTACCGACTACAATTACCAAACCCTAAAGGC
CAATGTGGATCTTCTAAAGTTGATTCAGCTTGGATTAACTTTTTCAGACGAGAATGGCAACTTGCCAAAATGTGGGACTGGGAAGTACTGTGTCTGGCAG
TTCAATTTCCGCGAATTCAACCCGGTTGAGGATTTCTATGCCGATGACTCCATAGAGCTTCTTACACAGAGTGGCATTGATTTCCAGAAGAACACCGAGG
TGGGTGTCGATACCAAGAGATTCAGTGAGTTGCTAATGTCGTCGGGGATTGTGTTGAATGACAATGTGCATTGGGTTACTTTCCATAGCGGGTATGATTT
TGGCTACCTGTTAAAGCTGCTCACTTGTAAGGACCTTCCTGACACACAATCAGAGTTCTTCAAGTTGATCAGGTTATACTTCCCTGTGCTCTATGATATC
AAGCACCTGGTCAAGTTCTGCAATAGTCTTCATGGTGGATTGAACAAGCTAGCGGAGCTGTTGGATGTAGAGAGGATTGGAATCTGTCACCAAGCCGGCT
CAGATAGTTTGCTTACATGTTGTACATTCATGAAATTGAAAGAGAGTTTCTTCAATAGTTCGACGGAGAAGTATGTTGGTGTGCTTTATGGCCTTGGTGT
TGAGAATGGTCAGAATGCTCATTAA
AA sequence
>Lus10003635 pacid=23141611 polypeptide=Lus10003635 locus=Lus10003635.g ID=Lus10003635.BGIv1.0 annot-version=v1.0
MSILPKSESIIIRDVWNENLEDEFNLIMDIVDDFPFIAMDTEFPGIIVRPVGNFKNGTDYNYQTLKANVDLLKLIQLGLTFSDENGNLPKCGTGKYCVWQ
FNFREFNPVEDFYADDSIELLTQSGIDFQKNTEVGVDTKRFSELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCKDLPDTQSEFFKLIRLYFPVLYDI
KHLVKFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTCCTFMKLKESFFNSSTEKYVGVLYGLGVENGQNAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32070 Polynucleotidyl transferase, r... Lus10003635 0 1
AT1G31830 Amino acid permease family pro... Lus10007593 1.0 0.9285
AT5G27930 Protein phosphatase 2C family ... Lus10029874 1.7 0.8960
AT1G47820 unknown protein Lus10031924 2.0 0.8738
AT4G03965 RING/U-box superfamily protein... Lus10029993 2.0 0.9003
AT2G32070 Polynucleotidyl transferase, r... Lus10036291 2.6 0.8680
AT2G43770 Transducin/WD40 repeat-like su... Lus10002211 2.8 0.8505
AT5G56440 F-box/RNI-like/FBD-like domain... Lus10023425 3.5 0.8375
AT5G67220 FMN-linked oxidoreductases sup... Lus10006260 4.5 0.8427
AT3G46790 CRR2 CHLORORESPIRATORY REDUCTION 2,... Lus10001558 6.5 0.8206
AT5G60790 ABCF1, ATGCN1 ARABIDOPSIS THALIANA GENERAL C... Lus10037947 8.0 0.8335

Lus10003635 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.