Lus10003641 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35410 251 / 7e-87 Clathrin adaptor complex small chain family protein (.1.2)
AT2G17380 248 / 1e-85 AP19 associated protein 19 (.1)
AT1G47830 134 / 8e-41 SNARE-like superfamily protein (.1)
AT2G19790 107 / 3e-30 SNARE-like superfamily protein (.1)
AT3G50860 92 / 5e-24 Clathrin adaptor complex small chain family protein (.1)
AT1G60780 40 / 0.0004 HAP13 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
AT1G10730 39 / 0.0005 Clathrin adaptor complexes medium subunit family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026316 228 / 2e-77 AT2G17380 297 / 7e-105 associated protein 19 (.1)
Lus10042352 228 / 3e-77 AT2G17380 297 / 3e-104 associated protein 19 (.1)
Lus10024337 136 / 2e-40 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1)
Lus10012924 106 / 9e-30 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
Lus10035004 103 / 8e-29 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1)
Lus10041742 95 / 5e-25 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1)
Lus10024011 82 / 6e-20 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1)
Lus10026688 42 / 6e-05 AT1G60780 813 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
Lus10004626 42 / 7e-05 AT1G60780 827 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G052000 255 / 2e-88 AT2G17380 307 / 6e-109 associated protein 19 (.1)
Potri.014G079000 250 / 2e-86 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2)
Potri.002G001800 223 / 1e-75 AT2G17380 278 / 3e-97 associated protein 19 (.1)
Potri.005G238701 136 / 1e-41 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1)
Potri.002G022900 132 / 6e-40 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1)
Potri.006G149100 108 / 8e-31 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1)
Potri.007G025400 97 / 8e-26 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
Potri.005G122900 95 / 4e-25 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
Potri.010G044700 44 / 1e-05 AT1G60780 834 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
Potri.008G187600 41 / 0.0002 AT1G60780 831 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Lus10003641 pacid=23141618 polypeptide=Lus10003641 locus=Lus10003641.g ID=Lus10003641.BGIv1.0 annot-version=v1.0
ATGGTATTCGACTTATTCACAGAAAGAACGATCCAAGGTAGGCTTAAAGGCTATTTTCTGTTGATAGCCATTTGTGACTGCCAAGGAGCCATCCGTGAGA
TTAGTGGAGTAATCTTAAGCCGAGGCCCGAAGCTCTGCAACTTTGTTGACTGGAAAGGACAGAAAGTTGTTTACAAAAGATATGCTAGCCTATATTTCTG
CATGTGCATTGATCAGGATGACAACGAGCTAGAGGTCCTTGAAATTATTCACCATTTCGTCGAGATTCTGGACAGATACTTTGGCAGTGTATGCGAGTTG
GATTTGATCTTCAACTTCCACAAGGCTTATTATATATTGGATGAGCTCCTAATCGCTGGCGAACTCCAGGAATCAAGCAAAAAAACAGTAGCCAAATTAA
TATCTGCACAGGATTCACTAGTAGAGGCTGCAAAAGAGGAGGCAAGCTCCATAAGCAATATAATTGCTCAGGCCACAAAGTAA
AA sequence
>Lus10003641 pacid=23141618 polypeptide=Lus10003641 locus=Lus10003641.g ID=Lus10003641.BGIv1.0 annot-version=v1.0
MVFDLFTERTIQGRLKGYFLLIAICDCQGAIREISGVILSRGPKLCNFVDWKGQKVVYKRYASLYFCMCIDQDDNELEVLEIIHHFVEILDRYFGSVCEL
DLIFNFHKAYYILDELLIAGELQESSKKTVAKLISAQDSLVEAAKEEASSISNIIAQATK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G35410 Clathrin adaptor complex small... Lus10003641 0 1
AT5G66410 PLP3B phosducin-like protein 3 homol... Lus10025176 1.4 0.8747
AT5G02280 SNARE-like superfamily protein... Lus10024390 2.0 0.8533
AT5G58030 Transport protein particle (TR... Lus10003634 2.4 0.8395
AT1G51260 LPAT3 lysophosphatidyl acyltransfera... Lus10027375 3.9 0.8605
AT1G68370 ARG1 ALTERED RESPONSE TO GRAVITY 1,... Lus10005113 8.4 0.8375
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10040468 9.1 0.8697
AT5G45550 MOB1-like MOB1-like, Mob1/phocein family... Lus10017172 10.0 0.8452
AT5G42770 Maf-like protein (.1.2) Lus10002531 10.6 0.7976
AT1G11050 Protein kinase superfamily pro... Lus10018860 12.6 0.8150
AT5G47540 Mo25 family protein (.1) Lus10027342 13.7 0.8021

Lus10003641 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.