Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G22200 132 / 3e-36 AKT3, AKT2/3 potassium transport 2/3 (.1) AT4G32500 94 / 7e-23 AKT5 K+ transporter 5, K+ transporter 5, K+ transporter 5 (.1) AT2G25600 87 / 4e-20 AKT6, SPIK Shaker pollen inward K+ channel, Shaker pollen inward K+ channel (.1) AT4G18290 86 / 4e-20 KAT2 potassium channel in Arabidopsis thaliana 2 (.1) AT5G46240 86 / 8e-20 KAT1 potassium channel in Arabidopsis thaliana 1 (.1) AT2G26650 79 / 2e-17 AKT1, ATAKT1 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) AT4G32650 77 / 8e-17 AtLKT1, KAT3, ATKC1 A. thaliana low-K+-tolerant 1, ARABIDOPSIS THALIANA K+ RECTIFYING CHANNEL 1, potassium channel in Arabidopsis thaliana 3 (.1.2.3) AT5G37500 69 / 3e-14 GORK gated outwardly-rectifying K+ channel, gated outwardly-rectifying K+ channel (.1) AT3G02850 69 / 6e-14 SKOR STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019944 [exp] 132 / 2e-36 AT4G22200 1111 / 0.0 potassium transport 2/3 (.1) Lus10015474 [exp] 131 / 8e-36 AT4G22200 1093 / 0.0 potassium transport 2/3 (.1) Lus10028128 [exp] 85 / 2e-19 AT5G46240 827 / 0.0 potassium channel in Arabidopsis thaliana 1 (.1) Lus10042831 [exp] 85 / 2e-19 AT5G46240 825 / 0.0 potassium channel in Arabidopsis thaliana 1 (.1) Lus10043298 [exp] 83 / 9e-19 AT2G26650 1250 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Lus10017766 [exp] 81 / 3e-18 AT2G26650 719 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Lus10019442 [exp] 81 / 4e-18 AT2G26650 1252 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Lus10033052 [exp] 80 / 7e-18 AT2G26650 1211 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Lus10007670 [exp] 78 / 3e-17 AT4G32650 724 / 0.0 A. thaliana low-K+-tolerant 1, ARABIDOPSIS THALIANA K+ RECTIFYING CHANNEL 1, potassium channel in Arabidopsis thaliana 3 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G018800 [exp] 133 / 2e-36 AT4G22200 1045 / 0.0 potassium transport 2/3 (.1) Potri.004G132200 [exp] 84 / 2e-19 AT5G46240 913 / 0.0 potassium channel in Arabidopsis thaliana 1 (.1) Potri.018G071400 [exp] 81 / 3e-18 AT2G26650 1192 / 0.0 K+ transporter 1, K+ transporter 1, K+ transporter 1 (.1) Potri.006G249900 [exp] 79 / 1e-17 AT2G25600 1065 / 0.0 Shaker pollen inward K+ channel, Shaker pollen inward K+ channel (.1) Potri.006G245000 [exp] 78 / 4e-17 AT4G32650 752 / 0.0 A. thaliana low-K+-tolerant 1, ARABIDOPSIS THALIANA K+ RECTIFYING CHANNEL 1, potassium channel in Arabidopsis thaliana 3 (.1.2.3) Potri.012G124944 [exp] 77 / 4e-17 AT4G32650 734 / 0.0 A. thaliana low-K+-tolerant 1, ARABIDOPSIS THALIANA K+ RECTIFYING CHANNEL 1, potassium channel in Arabidopsis thaliana 3 (.1.2.3) Potri.018G035500 [exp] 77 / 9e-17 AT4G32650 777 / 0.0 A. thaliana low-K+-tolerant 1, ARABIDOPSIS THALIANA K+ RECTIFYING CHANNEL 1, potassium channel in Arabidopsis thaliana 3 (.1.2.3) Potri.018G031600 [exp] 75 / 5e-16 AT2G25600 1078 / 0.0 Shaker pollen inward K+ channel, Shaker pollen inward K+ channel (.1) Potri.017G135400 [exp] 66 / 4e-13 AT3G02850 1269 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Potri.012G043000 [exp] 47 / 2e-06 AT3G02850 1032 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003645 pacid=23145343 polypeptide=Lus10003645 locus=Lus10003645.g ID=Lus10003645.BGIv1.0 annot-version=v1.0 ATGGGAGCCCAAATTAATGATGATTTTGATCATGATGAGGAGGAAGAGGTATCATTATCAATATCATCACCATCATCGTCAGCTCACTTCGTTCATGACT TGTCCAAGATTGTTCTTCCACCTTTAGGTATCTCAACTCAAGTCCATGCTCCACGGAGATCAAGAGGGGGCATCATTTCTCCCCTCGATTCAAGATACAG ATGTTGGGAGGCATTAATGGTGATGTTGGCAGCTTATTCAGTGTGGTTCTATCCTTTTGAGTTAGCATTCCTAGATCCCTCACATCACAAGGAGCTCTAC TTGTTGGACGTTACAACAGATGTGTTCTTTGCCTTTGACATCCTTCTCACCTTCTTCCTTGCTTACATCGACTCCAAGACCAATTTCATTGTTTATGATC CAACAAGAATTGCTAAGAGGTATAAACTAGACCTAATTCCCTATTTCATTTCATGTATTCCACATCGCATTCATCTGCATGCTCGATGA
AA sequence Show only first row Show all	>Lus10003645 pacid=23145343 polypeptide=Lus10003645 locus=Lus10003645.g ID=Lus10003645.BGIv1.0 annot-version=v1.0 MGAQINDDFDHDEEEEVSLSISSPSSSAHFVHDLSKIVLPPLGISTQVHAPRRSRGGIISPLDSRYRCWEALMVMLAAYSVWFYPFELAFLDPSHHKELY LLDVTTDVFFAFDILLTFFLAYIDSKTNFIVYDPTRIAKRYKLDLIPYFISCIPHRIHLHAR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G22200		AKT3, AKT2/3	potassium transport 2/3 (.1)		Lus10003645 [exp]	0	1
AT1G48120			hydrolases;protein serine/thre...		Lus10008569 [exp]	2.0	1.0000
					Lus10024550 [exp]	2.8	1.0000
AT5G49720		TSD1, IRX2, DEC...	TUMOROUS SHOOT DEVELOPMENT 1, ...		Lus10028619 [exp]	3.5	1.0000
					Lus10000550 [exp]	8.7	1.0000
					Lus10010778 [exp]	10.4	1.0000
AT5G46795		MSP2	microspore-specific promoter ...		Lus10004566 [exp]	11.6	1.0000
AT4G01830		ABCB5, PGP5	ATP-binding cassette B5, P-gly...		Lus10004529 [exp]	13.1	1.0000
					Lus10011496 [exp]	16.0	1.0000
					Lus10011061 [exp]	16.5	1.0000
AT3G07740		HXA2, HXA02, HA...	homolog of yeast ADA2 2A (.1.2...		Lus10012337 [exp]	16.9	1.0000

Compare expression of checked genes

Lus10003645 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.