Lus10003664 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27520 108 / 1e-29 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022283 286 / 6e-100 AT3G27520 142 / 7e-43 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G343200 163 / 1e-51 AT3G27520 113 / 1e-31 unknown protein
PFAM info
Representative CDS sequence
>Lus10003664 pacid=23171440 polypeptide=Lus10003664 locus=Lus10003664.g ID=Lus10003664.BGIv1.0 annot-version=v1.0
ATGGATTCCGCGCCCACAGCTTGGACGCCTGAGGAAGGCGAAGAGTGGGAGCTCCGCCACGACGAGGATGGATTCACTTATAAGATCCTCAAGCGCCAGC
GGCTCGACTTCCCCGTCCCAGATCCACCGCCTACGGATCCGGAGGCAGAAGAGAAACGCAGGAGGACGCGCAAGCGCGACGTGCTTTTGAAAGTGAAAAC
TCGGTACCAGAAGGAGATCCAACAATGGGAACTTTTGTCGAACAGCTTGCGAGCAATGGAGGAAAGAGTCAACCAACAACAGCTTCAGTCACGGGAACGG
TATCAATCGACGGACCCAACCGCTGCTGAAGGAACAGATTCGAGGGGAGTAGAAGAAGAAGACCCTTATGGGTCACTCGTGGATGAGCTCCTCTCTAAGG
CGGAAGCCCAAGAGGGAATCATCCGAAACATTTCAAACCTGTGCGATATAGCGGAAACAGTTTGTGATGCTCATCAGGATTTGTTAGTACAAACATTCAT
GAATCTACCAGTATGGTCTTCACCGCAAGAACTAATGGCATCGCTTTGTGATGACTGA
AA sequence
>Lus10003664 pacid=23171440 polypeptide=Lus10003664 locus=Lus10003664.g ID=Lus10003664.BGIv1.0 annot-version=v1.0
MDSAPTAWTPEEGEEWELRHDEDGFTYKILKRQRLDFPVPDPPPTDPEAEEKRRRTRKRDVLLKVKTRYQKEIQQWELLSNSLRAMEERVNQQQLQSRER
YQSTDPTAAEGTDSRGVEEEDPYGSLVDELLSKAEAQEGIIRNISNLCDIAETVCDAHQDLLVQTFMNLPVWSSPQELMASLCDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27520 unknown protein Lus10003664 0 1
AT2G15290 ATTIC21, TIC21,... PERMEASE IN CHLOROPLASTS 1, CH... Lus10014100 2.6 0.8081
AT4G04860 DER2.2 DERLIN-2.2 (.1) Lus10018347 4.0 0.7933
AT3G57120 Protein kinase superfamily pro... Lus10016113 9.8 0.7362
AT1G34380 5'-3' exonuclease family prote... Lus10006622 10.6 0.7366
AT4G14200 Pentatricopeptide repeat (PPR)... Lus10041255 11.7 0.7557
AT2G18280 TUB AtTLP2 tubby like protein 2 (.1.2) Lus10028309 14.5 0.7109
AT1G74520 ATHVA22A HVA22 homologue A (.1) Lus10008623 17.1 0.7779
AT1G31710 Copper amine oxidase family pr... Lus10004912 23.2 0.7270
AT3G58570 P-loop containing nucleoside t... Lus10030075 29.2 0.7356
AT2G40540 ATKUP2, ATKT2, ... potassium transporter 2 (.1.2) Lus10030539 30.4 0.7119

Lus10003664 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.