Lus10003670 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21610 198 / 2e-65 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT1G67600 176 / 1e-56 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 172 / 3e-55 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G61770 102 / 1e-26 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT3G12685 67 / 5e-14 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000883 295 / 7e-104 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10035299 189 / 1e-61 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030025 183 / 2e-58 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10011373 162 / 2e-51 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10006432 161 / 6e-51 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10036984 125 / 2e-37 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10030253 98 / 3e-26 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001841 66 / 5e-13 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001756 66 / 6e-13 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G087100 241 / 2e-82 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 175 / 3e-56 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.010G056600 175 / 4e-56 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.014G156000 170 / 2e-54 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G171300 105 / 1e-27 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G176100 56 / 1e-09 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Lus10003670 pacid=23149319 polypeptide=Lus10003670 locus=Lus10003670.g ID=Lus10003670.BGIv1.0 annot-version=v1.0
ATGAACGAAGTCATCACAGCTGCTGATGTATCAGCGAGGTTCCGATCAGCCGCATATCAGCCCTCCATCATCTCTTCTAATGTCCCACTCGTCACGGCCT
TCCTCGCATTAGCTATCGCCCAGTTCCTCAAACCTTTCACCGTCTGGTTCAAGGAGAGAAGATGGGATTCTCGAAGGATGCTTGGATCTGGTGGAATGCC
CTCCTCACATTCCGCAACGGTGACAGCACTTGCTGTGGCTGTTGCACTGCAGGAAGGAACCGGGGCACCAACTTTTGCTGTTGCACTGGTTTTGGCTTGC
GTTGTTATGTATGACGCTACTGGTGTTAGACTTCATGCTGGCCGTCAGGCTGAGTTATTGAATCAAATAGTGTGTGAGCTGCCTCCTGAACATCCTGTCT
CCAATTGTAGACCACTTCGGGATAGCCTTGGTCATACTCCCATCCAGGTTTGTTGCTCTCTCGCTGTTCCCGATTTGAAGGAATGGCCAACGTTCTGTTT
CAGAGTGCCCCGGAACTTGTCTAATGAAGGTGGTGTTAAGAACAATTAA
AA sequence
>Lus10003670 pacid=23149319 polypeptide=Lus10003670 locus=Lus10003670.g ID=Lus10003670.BGIv1.0 annot-version=v1.0
MNEVITAADVSARFRSAAYQPSIISSNVPLVTAFLALAIAQFLKPFTVWFKERRWDSRRMLGSGGMPSSHSATVTALAVAVALQEGTGAPTFAVALVLAC
VVMYDATGVRLHAGRQAELLNQIVCELPPEHPVSNCRPLRDSLGHTPIQVCCSLAVPDLKEWPTFCFRVPRNLSNEGGVKNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G21610 Acid phosphatase/vanadium-depe... Lus10003670 0 1
AT1G58190 AtRLP9 receptor like protein 9 (.1.2) Lus10002742 2.6 0.8076
AT5G47910 ATRBOHD, RBOHD respiratory burst oxidase homo... Lus10032517 6.2 0.7481
AT1G10140 Uncharacterised conserved prot... Lus10018665 22.4 0.6907
AT2G36780 UDP-Glycosyltransferase superf... Lus10007597 23.1 0.7145
AT1G15690 FUGU5, AtVHP1;1... FUGU 5, ARABIDOPSIS THALIANA V... Lus10039977 25.2 0.6858
AT2G05830 NagB/RpiA/CoA transferase-like... Lus10001970 25.3 0.7045
AT1G55170 unknown protein Lus10015628 40.4 0.5911
AT1G53050 Protein kinase superfamily pro... Lus10039836 45.2 0.6795
AT4G21700 Protein of unknown function (D... Lus10030937 51.0 0.6680
AT1G17980 PAPS1 poly(A) polymerase 1 (.1), pol... Lus10009011 52.9 0.6322

Lus10003670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.