Lus10003682 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25570 96 / 7e-24 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G14730 82 / 5e-19 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 79 / 2e-17 ACYB-1 cytochrome B561-1 (.1)
AT1G26100 73 / 2e-15 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028996 296 / 1e-102 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10039216 102 / 1e-26 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034427 100 / 9e-26 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 92 / 2e-22 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 86 / 8e-20 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 83 / 1e-18 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 82 / 1e-18 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10021715 58 / 6e-10 AT1G26100 241 / 3e-80 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034074 58 / 1e-09 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G102400 106 / 6e-28 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.015G143700 96 / 6e-24 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 95 / 1e-23 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 92 / 2e-22 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.004G103800 82 / 1e-18 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 80 / 6e-18 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.017G111700 73 / 2e-15 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.010G131100 65 / 2e-12 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 61 / 5e-11 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10003682 pacid=23179493 polypeptide=Lus10003682 locus=Lus10003682.g ID=Lus10003682.BGIv1.0 annot-version=v1.0
ATGAGCTCCATTGATTCCAAAGCAAGCAAACAATCAAGAATTCCACAGCAAGGAATTAACATGAGAGGGATGCAGATCTCGGCGTTACCGGTAACGGTAA
TGGCGCACTTGATAGCCATTGCTACGACGATCCTCGTCCTCGTCTGGCTCCTCAAGCTCCGAGATGGCCTCTCTTGGAGCATCGACCCCATCCCCAACAA
AGCTTTCAACGTGCATCCTCTAGTAATGGTGATTGGATTCATAATTGTATTAGGAGAAGATGCAGAAATAATGACGTATAAGACGGTGAGAGGCAAGAGA
AGAACGGTTCGAAAAGTGACTCATTTGGTTCTTCAGAGTGTAGCAATGGTTGCGGCAGTGTTTGGGGTGGTTGTGGTGTTTCGGTTCTACCACTTGATTC
ACTCTCCACACATGATCACTCTCCATTCCTGGCTTGGCATCATCACTGTTTCCTTGTTTGGGGCGGGGTTCTACATGTTCAAAGGGACAAAGATGCCGGC
GAAGGCGTCGTATCTCCCGTGGCATGTCTTCCTCGGGAGCATCATATTCCTGCTGGCGATCGCGACAGCCCTGACCGGCATAGTCCGGCAATTCGGAATC
CTAGGACTTGGTCGCGCCCAAGAAGGCCTCATCGTCAACTTCATCGGACTTTTACTTGTTCTTTACGCCGTCGCCGTCGGACTCGCTGTCTCGCTCCCTT
ATGAGAGGTGA
AA sequence
>Lus10003682 pacid=23179493 polypeptide=Lus10003682 locus=Lus10003682.g ID=Lus10003682.BGIv1.0 annot-version=v1.0
MSSIDSKASKQSRIPQQGINMRGMQISALPVTVMAHLIAIATTILVLVWLLKLRDGLSWSIDPIPNKAFNVHPLVMVIGFIIVLGEDAEIMTYKTVRGKR
RTVRKVTHLVLQSVAMVAAVFGVVVVFRFYHLIHSPHMITLHSWLGIITVSLFGAGFYMFKGTKMPAKASYLPWHVFLGSIIFLLAIATALTGIVRQFGI
LGLGRAQEGLIVNFIGLLLVLYAVAVGLAVSLPYER

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10003682 0 1

Lus10003682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.