Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19985 66 / 6e-15 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028990 [exp] 138 / 2e-42 AT4G19985 204 / 1e-65 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G065400 [exp] 99 / 4e-27 AT4G19985 213 / 3e-69 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003689 pacid=23179474 polypeptide=Lus10003689 locus=Lus10003689.g ID=Lus10003689.BGIv1.0 annot-version=v1.0 ATGGTGTTCATAATATTGACAAGCAGAGACATCTATGACATTGCAGCCCTTTGCTCACCCAAGGAGAGGCTATTCTTCAGTGCTTGTGGGTTTAGGGATG ACATTTTGGGATCCACAACAATGATGTACACAAGAACAGCCTCGATCCATGACGACGGTTCCGGTAAACTTGTTGGTAGGAAGCTTTTGCTGATTCCTCC TCTTAAGGTGACACAGTTAGAGAATCTGTAG
AA sequence Show only first row Show all	>Lus10003689 pacid=23179474 polypeptide=Lus10003689 locus=Lus10003689.g ID=Lus10003689.BGIv1.0 annot-version=v1.0 MVFIILTSRDIYDIAALCSPKERLFFSACGFRDDILGSTTMMYTRTASIHDDGSGKLVGRKLLLIPPLKVTQLENL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19985			Acyl-CoA N-acyltransferases (N...		Lus10003689 [exp]	0	1
AT1G71160		KCS7	3-ketoacyl-CoA synthase 7 (.1)		Lus10029880 [exp]	4.6	0.7229
AT2G02148			unknown protein		Lus10031926 [exp]	5.7	0.7102
AT5G15070			Phosphoglycerate mutase-like f...		Lus10008307 [exp]	7.7	0.7597
AT4G28560		RIC7	ROP-interactive CRIB motif-con...		Lus10003624 [exp]	9.1	0.7325
AT5G20990		B73, CNX1, SIR4...	SIRTINOL 4, CO-FACTOR FOR NITR...		Lus10001152 [exp]	16.5	0.6530
AT5G62650			Tic22-like family protein (.1)		Lus10027537 [exp]	16.6	0.7045
					Lus10015768 [exp]	22.8	0.6945
AT3G12150			unknown protein		Lus10023826 [exp]	25.7	0.6922
AT5G62430	DOF	CDF1, AtDof5,5	cycling DOF factor 1 (.1)		Lus10020314 [exp]	26.4	0.6492
AT3G01310			Phosphoglycerate mutase-like f...		Lus10015343 [exp]	31.1	0.6916

Compare expression of checked genes

Lus10003689 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.